Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   ACLCDX_RS08845 Genome accession   NZ_CP180263
Coordinates   1768584..1768964 (+) Length   126 a.a.
NCBI ID   WP_051149980.1    Uniprot ID   -
Organism   Bacillus safensis strain BS22LVI     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1735383..1773378 1768584..1768964 within 0


Gene organization within MGE regions


Location: 1735383..1773378
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLCDX_RS08675 (ACLCDX_08675) - 1735383..1736222 (+) 840 WP_024424079.1 hypothetical protein -
  ACLCDX_RS08680 (ACLCDX_08680) - 1736267..1736648 (+) 382 Protein_1661 ArpU family phage packaging/lysis transcriptional regulator -
  ACLCDX_RS08685 (ACLCDX_08685) - 1736778..1738378 (+) 1601 Protein_1662 ribonuclease YeeF family protein -
  ACLCDX_RS08690 (ACLCDX_08690) - 1738383..1738766 (+) 384 WP_024425095.1 immunity 22 family protein -
  ACLCDX_RS08695 (ACLCDX_08695) - 1738840..1739244 (+) 405 WP_024425096.1 hypothetical protein -
  ACLCDX_RS08700 (ACLCDX_08700) - 1739712..1739891 (+) 180 WP_024425097.1 hypothetical protein -
  ACLCDX_RS08705 (ACLCDX_08705) - 1739983..1740327 (+) 345 WP_024425098.1 hypothetical protein -
  ACLCDX_RS08710 (ACLCDX_08710) - 1740644..1741012 (+) 369 WP_024425099.1 nuclear transport factor 2 family protein -
  ACLCDX_RS08715 (ACLCDX_08715) - 1741661..1741837 (+) 177 WP_258011175.1 ParB N-terminal domain-containing protein -
  ACLCDX_RS08720 (ACLCDX_08720) - 1741853..1742362 (+) 510 WP_024425101.1 phage minor head protein -
  ACLCDX_RS08725 (ACLCDX_08725) - 1742405..1743055 (+) 651 WP_024425102.1 hypothetical protein -
  ACLCDX_RS08730 (ACLCDX_08730) - 1743093..1744111 (+) 1019 Protein_1671 XkdF-like putative serine protease domain-containing protein -
  ACLCDX_RS08735 (ACLCDX_08735) - 1744421..1745038 (+) 618 WP_134817554.1 hypothetical protein -
  ACLCDX_RS08740 (ACLCDX_08740) - 1745270..1745689 (+) 420 WP_024425104.1 hypothetical protein -
  ACLCDX_RS08745 (ACLCDX_08745) - 1746066..1747991 (+) 1926 WP_024425105.1 T7SS effector LXG polymorphic toxin -
  ACLCDX_RS08750 (ACLCDX_08750) - 1747995..1748471 (+) 477 WP_024425106.1 immunity protein YezG family protein -
  ACLCDX_RS08755 (ACLCDX_08755) - 1748536..1748997 (-) 462 WP_024425107.1 macro domain-containing protein -
  ACLCDX_RS08760 (ACLCDX_08760) - 1749226..1749807 (+) 582 WP_024425108.1 undecaprenyl-diphosphatase -
  ACLCDX_RS08765 (ACLCDX_08765) - 1749858..1750229 (-) 372 WP_024425109.1 iron chaperone -
  ACLCDX_RS08770 (ACLCDX_08770) - 1750771..1751883 (+) 1113 WP_024425110.1 tetratricopeptide repeat protein -
  ACLCDX_RS08775 (ACLCDX_08775) - 1752613..1753308 (-) 696 WP_087978168.1 YoaK family protein -
  ACLCDX_RS08780 (ACLCDX_08780) - 1753376..1755207 (-) 1832 Protein_1681 DNA ligase D -
  ACLCDX_RS08785 (ACLCDX_08785) - 1755323..1756171 (+) 849 WP_024425113.1 Ku protein -
  ACLCDX_RS08790 (ACLCDX_08790) - 1756388..1756831 (-) 444 WP_024425114.1 DUF2188 domain-containing protein -
  ACLCDX_RS08795 (ACLCDX_08795) - 1756997..1757470 (+) 474 WP_051170147.1 VOC family protein -
  ACLCDX_RS08800 (ACLCDX_08800) - 1757519..1757932 (+) 414 WP_024425116.1 Rrf2 family transcriptional regulator -
  ACLCDX_RS08805 (ACLCDX_08805) - 1758033..1758884 (+) 852 WP_024425117.1 SDR family oxidoreductase -
  ACLCDX_RS08810 (ACLCDX_08810) - 1759039..1759947 (+) 909 WP_024425118.1 DMT family transporter -
  ACLCDX_RS08815 (ACLCDX_08815) - 1759960..1760151 (-) 192 WP_024425119.1 hypothetical protein -
  ACLCDX_RS08820 (ACLCDX_08820) - 1760262..1762478 (+) 2217 WP_024425120.1 RNA ligase -
  ACLCDX_RS08825 (ACLCDX_08825) - 1762543..1763253 (+) 711 WP_024425121.1 DUF421 domain-containing protein -
  ACLCDX_RS08830 (ACLCDX_08830) - 1763480..1764058 (+) 579 WP_024425122.1 TetR/AcrR family transcriptional regulator -
  ACLCDX_RS08835 (ACLCDX_08835) - 1764080..1767223 (+) 3144 WP_149126620.1 bifunctional cytochrome P450/NADPH--P450 reductase -
  ACLCDX_RS08840 (ACLCDX_08840) - 1767417..1768325 (+) 909 WP_024425124.1 trypsin-like serine peptidase -
  ACLCDX_RS08845 (ACLCDX_08845) nucA/comI 1768584..1768964 (+) 381 WP_051149980.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  ACLCDX_RS08850 (ACLCDX_08850) - 1769110..1769958 (+) 849 WP_025093249.1 STAS domain-containing protein -
  ACLCDX_RS08855 (ACLCDX_08855) - 1769991..1770533 (-) 543 WP_025093248.1 IseA DL-endopeptidase inhibitor family protein -
  ACLCDX_RS08860 (ACLCDX_08860) - 1770829..1771278 (+) 450 WP_415316265.1 hypothetical protein -
  ACLCDX_RS08865 (ACLCDX_08865) lexA 1771323..1771943 (-) 621 WP_024425129.1 transcriptional repressor LexA -
  ACLCDX_RS08870 (ACLCDX_08870) yneA 1772102..1772413 (+) 312 WP_024425130.1 cell division suppressor protein YneA -
  ACLCDX_RS08875 (ACLCDX_08875) - 1772431..1773078 (+) 648 WP_122631359.1 recombinase family protein -
  ACLCDX_RS08880 (ACLCDX_08880) - 1773148..1773378 (+) 231 WP_024425132.1 DUF896 domain-containing protein -

Sequence


Protein


Download         Length: 126 a.a.        Molecular weight: 13761.43 Da        Isoelectric Point: 8.5068

>NTDB_id=1094972 ACLCDX_RS08845 WP_051149980.1 1768584..1768964(+) (nucA/comI) [Bacillus safensis strain BS22LVI]
MGTLFGGFGEKQAAKGADRYDHVVQFPKERYPETGSHIQEAIRKGHSDVCTIDRNGADARRQESLKGIPTKPGFDRDEWP
MAVCLEGGKGASVQYVSPSDNRGAGSWVGHQISGFPDGKRILFIVK

Nucleotide


Download         Length: 381 bp        

>NTDB_id=1094972 ACLCDX_RS08845 WP_051149980.1 1768584..1768964(+) (nucA/comI) [Bacillus safensis strain BS22LVI]
ATGGGCACGTTGTTTGGCGGATTTGGAGAGAAGCAGGCAGCAAAAGGGGCTGATCGATATGATCATGTCGTTCAATTTCC
AAAGGAAAGGTACCCTGAAACAGGCAGTCATATTCAAGAAGCCATTCGAAAAGGGCATTCAGATGTGTGTACCATTGACC
GAAATGGAGCAGATGCCCGCAGGCAAGAATCATTAAAAGGAATTCCGACAAAACCTGGCTTTGACCGGGATGAATGGCCA
ATGGCGGTTTGTCTTGAGGGAGGAAAAGGCGCAAGCGTTCAATATGTCAGTCCATCTGATAATAGGGGAGCAGGCTCATG
GGTCGGGCATCAAATCAGCGGGTTTCCTGATGGGAAAAGAATATTATTCATTGTGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

57.983

94.444

0.548


Multiple sequence alignment