Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   ACLCDX_RS00255 Genome accession   NZ_CP180263
Coordinates   47308..47598 (-) Length   96 a.a.
NCBI ID   WP_087975202.1    Uniprot ID   -
Organism   Bacillus safensis strain BS22LVI     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 23538..54008 47308..47598 within 0


Gene organization within MGE regions


Location: 23538..54008
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLCDX_RS00100 (ACLCDX_00100) - 24036..24368 (+) 333 Protein_14 methyl-accepting chemotaxis protein -
  ACLCDX_RS00110 (ACLCDX_00110) - 24875..25534 (-) 660 WP_149126080.1 deoxynucleoside kinase -
  ACLCDX_RS00115 (ACLCDX_00115) - 25531..26154 (-) 624 WP_024425759.1 deoxynucleoside kinase -
  ACLCDX_RS00120 (ACLCDX_00120) - 26240..27487 (-) 1248 WP_229137482.1 glycoside hydrolase family 18 protein -
  ACLCDX_RS00125 (ACLCDX_00125) - 27587..28141 (-) 555 WP_024426742.1 isochorismatase family cysteine hydrolase -
  ACLCDX_RS00130 (ACLCDX_00130) tadA 28221..28697 (+) 477 WP_024426741.1 tRNA adenosine(34) deaminase TadA -
  ACLCDX_RS00140 (ACLCDX_00140) dnaX 29369..31081 (+) 1713 WP_149126079.1 DNA polymerase III subunit gamma/tau -
  ACLCDX_RS00145 (ACLCDX_00145) - 31108..31431 (+) 324 WP_008342011.1 YbaB/EbfC family nucleoid-associated protein -
  ACLCDX_RS00150 (ACLCDX_00150) recR 31447..32043 (+) 597 WP_003218094.1 recombination protein RecR -
  ACLCDX_RS00155 (ACLCDX_00155) - 32062..32286 (+) 225 WP_024425764.1 YaaL family protein -
  ACLCDX_RS00160 (ACLCDX_00160) - 32353..32616 (+) 264 WP_024425765.1 pro-sigmaK processing inhibitor BofA family protein -
  ACLCDX_RS00190 (ACLCDX_00190) - 38124..38315 (+) 192 WP_024425620.1 sigma factor G inhibitor Gin -
  ACLCDX_RS00195 (ACLCDX_00195) - 38444..39058 (+) 615 WP_034624452.1 5-bromo-4-chloroindolyl phosphate hydrolysis family protein -
  ACLCDX_RS00200 (ACLCDX_00200) - 39077..40141 (+) 1065 WP_056768450.1 toxic anion resistance protein -
  ACLCDX_RS00205 (ACLCDX_00205) - 40219..41627 (+) 1409 Protein_28 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  ACLCDX_RS00210 (ACLCDX_00210) tmk 41624..42260 (+) 637 Protein_29 dTMP kinase -
  ACLCDX_RS00215 (ACLCDX_00215) - 42340..42669 (+) 330 WP_024425625.1 cyclic-di-AMP receptor -
  ACLCDX_RS00220 (ACLCDX_00220) - 42682..43122 (+) 441 WP_024425626.1 YaaR family protein -
  ACLCDX_RS00225 (ACLCDX_00225) holB 43134..44123 (+) 990 WP_024427206.1 DNA polymerase III subunit delta' -
  ACLCDX_RS00230 (ACLCDX_00230) - 44126..44953 (+) 828 WP_024425628.1 stage 0 sporulation family protein -
  ACLCDX_RS00235 (ACLCDX_00235) yabA 44968..45321 (+) 354 WP_024425629.1 DNA replication initiation control protein YabA -
  ACLCDX_RS00240 (ACLCDX_00240) - 45377..46120 (+) 744 WP_024427205.1 tRNA1(Val) (adenine(37)-N6)-methyltransferase -
  ACLCDX_RS00245 (ACLCDX_00245) - 46107..46406 (+) 300 WP_024425631.1 GIY-YIG nuclease family protein -
  ACLCDX_RS00250 (ACLCDX_00250) rsmI 46381..47262 (+) 882 WP_197172573.1 16S rRNA (cytidine(1402)-2'-O)-methyltransferase -
  ACLCDX_RS00255 (ACLCDX_00255) abrB 47308..47598 (-) 291 WP_087975202.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  ACLCDX_RS00260 (ACLCDX_00260) metG 48119..50119 (+) 2001 WP_197172571.1 methionine--tRNA ligase -
  ACLCDX_RS00265 (ACLCDX_00265) - 50201..50968 (+) 768 WP_024425634.1 TatD family hydrolase -
  ACLCDX_RS00270 (ACLCDX_00270) - 51213..52415 (+) 1203 WP_034624439.1 G5 and 3D domain-containing protein -
  ACLCDX_RS00275 (ACLCDX_00275) rnmV 52577..53137 (+) 561 WP_017359323.1 ribonuclease M5 -
  ACLCDX_RS00280 (ACLCDX_00280) rsmA 53130..54008 (+) 879 WP_056768438.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -

Sequence


Protein


Download         Length: 96 a.a.        Molecular weight: 10853.65 Da        Isoelectric Point: 7.9655

>NTDB_id=1094946 ACLCDX_RS00255 WP_087975202.1 47308..47598(-) (abrB) [Bacillus safensis strain BS22LVI]
MKMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLANGKLVLSREG
AEQIINEIQNQLQSQK

Nucleotide


Download         Length: 291 bp        

>NTDB_id=1094946 ACLCDX_RS00255 WP_087975202.1 47308..47598(-) (abrB) [Bacillus safensis strain BS22LVI]
ATGAAGATGAAATCTACAGGTATTGTACGTAAAGTTGACGAATTAGGACGCGTGGTGATTCCAATCGAACTTCGCCGTAC
GCTAGGAATCGCTGAAAAAGACGCTTTGGAAATTTATGTTGATGATGAAAAAATTATCTTAAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACAGGTGAAGTATCAGACGATAACCTTAAACTTGCTAATGGTAAATTAGTTCTTAGCCGTGAAGGT
GCAGAGCAAATCATTAACGAAATCCAAAACCAACTTCAATCACAAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

93.75

100

0.938


Multiple sequence alignment