Detailed information
Overview
| Name | abrB | Type | Regulator |
| Locus tag | ACLCDX_RS00255 | Genome accession | NZ_CP180263 |
| Coordinates | 47308..47598 (-) | Length | 96 a.a. |
| NCBI ID | WP_087975202.1 | Uniprot ID | - |
| Organism | Bacillus safensis strain BS22LVI | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 23538..54008 | 47308..47598 | within | 0 |
Gene organization within MGE regions
Location: 23538..54008
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLCDX_RS00100 (ACLCDX_00100) | - | 24036..24368 (+) | 333 | Protein_14 | methyl-accepting chemotaxis protein | - |
| ACLCDX_RS00110 (ACLCDX_00110) | - | 24875..25534 (-) | 660 | WP_149126080.1 | deoxynucleoside kinase | - |
| ACLCDX_RS00115 (ACLCDX_00115) | - | 25531..26154 (-) | 624 | WP_024425759.1 | deoxynucleoside kinase | - |
| ACLCDX_RS00120 (ACLCDX_00120) | - | 26240..27487 (-) | 1248 | WP_229137482.1 | glycoside hydrolase family 18 protein | - |
| ACLCDX_RS00125 (ACLCDX_00125) | - | 27587..28141 (-) | 555 | WP_024426742.1 | isochorismatase family cysteine hydrolase | - |
| ACLCDX_RS00130 (ACLCDX_00130) | tadA | 28221..28697 (+) | 477 | WP_024426741.1 | tRNA adenosine(34) deaminase TadA | - |
| ACLCDX_RS00140 (ACLCDX_00140) | dnaX | 29369..31081 (+) | 1713 | WP_149126079.1 | DNA polymerase III subunit gamma/tau | - |
| ACLCDX_RS00145 (ACLCDX_00145) | - | 31108..31431 (+) | 324 | WP_008342011.1 | YbaB/EbfC family nucleoid-associated protein | - |
| ACLCDX_RS00150 (ACLCDX_00150) | recR | 31447..32043 (+) | 597 | WP_003218094.1 | recombination protein RecR | - |
| ACLCDX_RS00155 (ACLCDX_00155) | - | 32062..32286 (+) | 225 | WP_024425764.1 | YaaL family protein | - |
| ACLCDX_RS00160 (ACLCDX_00160) | - | 32353..32616 (+) | 264 | WP_024425765.1 | pro-sigmaK processing inhibitor BofA family protein | - |
| ACLCDX_RS00190 (ACLCDX_00190) | - | 38124..38315 (+) | 192 | WP_024425620.1 | sigma factor G inhibitor Gin | - |
| ACLCDX_RS00195 (ACLCDX_00195) | - | 38444..39058 (+) | 615 | WP_034624452.1 | 5-bromo-4-chloroindolyl phosphate hydrolysis family protein | - |
| ACLCDX_RS00200 (ACLCDX_00200) | - | 39077..40141 (+) | 1065 | WP_056768450.1 | toxic anion resistance protein | - |
| ACLCDX_RS00205 (ACLCDX_00205) | - | 40219..41627 (+) | 1409 | Protein_28 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| ACLCDX_RS00210 (ACLCDX_00210) | tmk | 41624..42260 (+) | 637 | Protein_29 | dTMP kinase | - |
| ACLCDX_RS00215 (ACLCDX_00215) | - | 42340..42669 (+) | 330 | WP_024425625.1 | cyclic-di-AMP receptor | - |
| ACLCDX_RS00220 (ACLCDX_00220) | - | 42682..43122 (+) | 441 | WP_024425626.1 | YaaR family protein | - |
| ACLCDX_RS00225 (ACLCDX_00225) | holB | 43134..44123 (+) | 990 | WP_024427206.1 | DNA polymerase III subunit delta' | - |
| ACLCDX_RS00230 (ACLCDX_00230) | - | 44126..44953 (+) | 828 | WP_024425628.1 | stage 0 sporulation family protein | - |
| ACLCDX_RS00235 (ACLCDX_00235) | yabA | 44968..45321 (+) | 354 | WP_024425629.1 | DNA replication initiation control protein YabA | - |
| ACLCDX_RS00240 (ACLCDX_00240) | - | 45377..46120 (+) | 744 | WP_024427205.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| ACLCDX_RS00245 (ACLCDX_00245) | - | 46107..46406 (+) | 300 | WP_024425631.1 | GIY-YIG nuclease family protein | - |
| ACLCDX_RS00250 (ACLCDX_00250) | rsmI | 46381..47262 (+) | 882 | WP_197172573.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| ACLCDX_RS00255 (ACLCDX_00255) | abrB | 47308..47598 (-) | 291 | WP_087975202.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| ACLCDX_RS00260 (ACLCDX_00260) | metG | 48119..50119 (+) | 2001 | WP_197172571.1 | methionine--tRNA ligase | - |
| ACLCDX_RS00265 (ACLCDX_00265) | - | 50201..50968 (+) | 768 | WP_024425634.1 | TatD family hydrolase | - |
| ACLCDX_RS00270 (ACLCDX_00270) | - | 51213..52415 (+) | 1203 | WP_034624439.1 | G5 and 3D domain-containing protein | - |
| ACLCDX_RS00275 (ACLCDX_00275) | rnmV | 52577..53137 (+) | 561 | WP_017359323.1 | ribonuclease M5 | - |
| ACLCDX_RS00280 (ACLCDX_00280) | rsmA | 53130..54008 (+) | 879 | WP_056768438.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
Sequence
Protein
Download Length: 96 a.a. Molecular weight: 10853.65 Da Isoelectric Point: 7.9655
>NTDB_id=1094946 ACLCDX_RS00255 WP_087975202.1 47308..47598(-) (abrB) [Bacillus safensis strain BS22LVI]
MKMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLANGKLVLSREG
AEQIINEIQNQLQSQK
MKMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMTCQVTGEVSDDNLKLANGKLVLSREG
AEQIINEIQNQLQSQK
Nucleotide
Download Length: 291 bp
>NTDB_id=1094946 ACLCDX_RS00255 WP_087975202.1 47308..47598(-) (abrB) [Bacillus safensis strain BS22LVI]
ATGAAGATGAAATCTACAGGTATTGTACGTAAAGTTGACGAATTAGGACGCGTGGTGATTCCAATCGAACTTCGCCGTAC
GCTAGGAATCGCTGAAAAAGACGCTTTGGAAATTTATGTTGATGATGAAAAAATTATCTTAAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACAGGTGAAGTATCAGACGATAACCTTAAACTTGCTAATGGTAAATTAGTTCTTAGCCGTGAAGGT
GCAGAGCAAATCATTAACGAAATCCAAAACCAACTTCAATCACAAAAATAA
ATGAAGATGAAATCTACAGGTATTGTACGTAAAGTTGACGAATTAGGACGCGTGGTGATTCCAATCGAACTTCGCCGTAC
GCTAGGAATCGCTGAAAAAGACGCTTTGGAAATTTATGTTGATGATGAAAAAATTATCTTAAAAAAATATAAACCAAACA
TGACTTGCCAAGTAACAGGTGAAGTATCAGACGATAACCTTAAACTTGCTAATGGTAAATTAGTTCTTAGCCGTGAAGGT
GCAGAGCAAATCATTAACGAAATCCAAAACCAACTTCAATCACAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
93.75 |
100 |
0.938 |