Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACLBKY_RS14785 Genome accession   NZ_CP180233
Coordinates   2851064..2851204 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain Ba 5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2846064..2856204
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLBKY_RS14760 (ACLBKY_14760) - 2846386..2846775 (-) 390 WP_008345855.1 hotdog fold thioesterase -
  ACLBKY_RS14765 (ACLBKY_14765) comA 2846799..2847440 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  ACLBKY_RS14770 (ACLBKY_14770) comP 2847521..2849827 (-) 2307 WP_017358942.1 ATP-binding protein Regulator
  ACLBKY_RS14775 (ACLBKY_14775) comX 2849841..2850011 (-) 171 WP_017358941.1 competence pheromone ComX -
  ACLBKY_RS14780 (ACLBKY_14780) - 2849989..2850912 (-) 924 WP_341275289.1 polyprenyl synthetase family protein -
  ACLBKY_RS14785 (ACLBKY_14785) degQ 2851064..2851204 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACLBKY_RS14790 (ACLBKY_14790) - 2851710..2852066 (+) 357 WP_050826564.1 hypothetical protein -
  ACLBKY_RS14795 (ACLBKY_14795) - 2852103..2853329 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  ACLBKY_RS14800 (ACLBKY_14800) - 2853469..2854938 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  ACLBKY_RS14805 (ACLBKY_14805) - 2854956..2855507 (-) 552 WP_025207909.1 cysteine hydrolase family protein -
  ACLBKY_RS14810 (ACLBKY_14810) - 2855568..2855975 (-) 408 WP_394157988.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1094758 ACLBKY_RS14785 WP_003213123.1 2851064..2851204(-) (degQ) [Bacillus altitudinis strain Ba 5]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1094758 ACLBKY_RS14785 WP_003213123.1 2851064..2851204(-) (degQ) [Bacillus altitudinis strain Ba 5]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment