Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   ACME8E_RS23945 Genome accession   NZ_CP178917
Coordinates   5375877..5376323 (-) Length   148 a.a.
NCBI ID   WP_413986261.1    Uniprot ID   -
Organism   Paenibacillus polymyxa strain AF2927     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 5353860..5385168 5375877..5376323 within 0


Gene organization within MGE regions


Location: 5353860..5385168
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACME8E_RS23810 - 5354074..5354712 (+) 639 WP_165080749.1 hypothetical protein -
  ACME8E_RS23815 - 5354899..5355354 (+) 456 WP_081317847.1 AraC family transcriptional regulator -
  ACME8E_RS23820 - 5355268..5355822 (-) 555 WP_058829663.1 hypothetical protein -
  ACME8E_RS23825 - 5355794..5356198 (-) 405 WP_165080753.1 hypothetical protein -
  ACME8E_RS23830 abc-f 5356665..5358152 (+) 1488 WP_165080755.1 ribosomal protection-like ABC-F family protein -
  ACME8E_RS23835 - 5359338..5360156 (-) 819 WP_413986249.1 alpha/beta fold hydrolase -
  ACME8E_RS23840 - 5360426..5360689 (-) 264 WP_013371533.1 hypothetical protein -
  ACME8E_RS23845 - 5360963..5361880 (-) 918 WP_413986250.1 hypothetical protein -
  ACME8E_RS23850 - 5363125..5363316 (+) 192 WP_228392861.1 hypothetical protein -
  ACME8E_RS23855 - 5363552..5363773 (+) 222 WP_064964227.1 DUF6199 family natural product biosynthesis protein -
  ACME8E_RS23860 - 5364420..5364623 (-) 204 WP_071558640.1 hypothetical protein -
  ACME8E_RS23865 - 5365061..5365456 (-) 396 WP_413986251.1 LytTR family transcriptional regulator DNA-binding domain-containing protein -
  ACME8E_RS23870 - 5365472..5365618 (-) 147 WP_071558638.1 cyclic lactone autoinducer peptide -
  ACME8E_RS23875 - 5365596..5366150 (-) 555 WP_071558637.1 accessory gene regulator B family protein -
  ACME8E_RS23880 - 5366128..5366760 (-) 633 WP_071558636.1 hypothetical protein -
  ACME8E_RS23885 - 5366946..5367206 (-) 261 WP_071558635.1 group-specific protein -
  ACME8E_RS23890 - 5367300..5368367 (-) 1068 WP_413986252.1 thermonuclease family protein -
  ACME8E_RS23895 - 5368480..5368815 (-) 336 WP_413986253.1 YolD-like family protein -
  ACME8E_RS23900 - 5368982..5369656 (+) 675 WP_413986254.1 hypothetical protein -
  ACME8E_RS23905 - 5369878..5369961 (-) 84 WP_223822117.1 putative holin-like toxin -
  ACME8E_RS23910 - 5370328..5370717 (-) 390 WP_413986255.1 hypothetical protein -
  ACME8E_RS23915 - 5370732..5371877 (-) 1146 WP_413986256.1 hypothetical protein -
  ACME8E_RS23920 - 5372194..5373054 (+) 861 WP_413986257.1 ATP-dependent DNA ligase -
  ACME8E_RS23925 - 5373105..5374166 (-) 1062 WP_413986258.1 fibronectin type III domain-containing protein -
  ACME8E_RS23930 - 5374316..5374549 (-) 234 WP_413986259.1 hypothetical protein -
  ACME8E_RS23935 - 5374665..5375072 (-) 408 WP_250271271.1 hypothetical protein -
  ACME8E_RS23940 - 5375098..5375610 (-) 513 WP_413986260.1 hypothetical protein -
  ACME8E_RS23945 nucA/comI 5375877..5376323 (-) 447 WP_413986261.1 nuclease Machinery gene
  ACME8E_RS23950 - 5376452..5376760 (-) 309 WP_413986262.1 DUF2500 family protein -
  ACME8E_RS23955 - 5377002..5377589 (-) 588 WP_413986263.1 hypothetical protein -
  ACME8E_RS23960 - 5377766..5378644 (-) 879 WP_413986264.1 hypothetical protein -
  ACME8E_RS23965 - 5378718..5378876 (-) 159 WP_413986265.1 hypothetical protein -
  ACME8E_RS23970 - 5379038..5379592 (-) 555 WP_413986266.1 phage holin, LLH family -
  ACME8E_RS23975 - 5379595..5380545 (-) 951 WP_413986267.1 GH25 family lysozyme -
  ACME8E_RS23980 - 5380523..5380978 (-) 456 WP_413986268.1 holin family protein -
  ACME8E_RS23985 - 5381002..5381217 (-) 216 WP_413986269.1 hypothetical protein -
  ACME8E_RS23990 - 5381275..5381496 (-) 222 WP_413986270.1 hypothetical protein -
  ACME8E_RS23995 - 5381477..5381629 (-) 153 WP_413986271.1 hypothetical protein -
  ACME8E_RS24000 - 5381659..5382465 (-) 807 WP_413986272.1 BRO family protein -
  ACME8E_RS24005 - 5383482..5383775 (+) 294 WP_413986273.1 hypothetical protein -
  ACME8E_RS24010 - 5383978..5384433 (+) 456 WP_413986274.1 AraC family transcriptional regulator -
  ACME8E_RS24015 - 5384572..5385168 (-) 597 WP_413986275.1 2,' 3'-cyclic nucleotide 2'-phosphodiesterase -

Sequence

Protein


Download         Length: 148 a.a.        Molecular weight: 16195.40 Da        Isoelectric Point: 6.2364

>NTDB_id=1092475 ACME8E_RS23945 WP_413986261.1 5375877..5376323(-) (nucA/comI) [Paenibacillus polymyxa strain AF2927]
MFRWIFTVLITVLLAGCSVQQDVVKTTKSDPVAVPVTQVSADTVKLEFPSDRYPETAQHIKEAIAAGKSSVCTIDREGAD
HNRELSLKGVPTKKGKDRDEWPMAMCAEGGEGADIKYISPKDNRGAGSWVGHKLDDYADGTRVEFIVK

Nucleotide


Download         Length: 447 bp        

>NTDB_id=1092475 ACME8E_RS23945 WP_413986261.1 5375877..5376323(-) (nucA/comI) [Paenibacillus polymyxa strain AF2927]
ATGTTTAGATGGATATTTACCGTGTTGATAACAGTCCTATTAGCTGGCTGCAGCGTACAACAAGACGTTGTAAAGACCAC
TAAGAGCGACCCTGTAGCCGTTCCGGTAACGCAGGTATCTGCCGATACAGTCAAGCTGGAATTTCCGTCAGACCGTTATC
CCGAAACAGCACAGCACATTAAAGAGGCTATAGCAGCCGGAAAGTCATCAGTATGCACCATAGACCGCGAAGGAGCCGAC
CATAATCGCGAGTTGTCCCTAAAGGGTGTACCCACCAAGAAGGGCAAAGATCGCGATGAATGGCCTATGGCGATGTGTGC
AGAAGGTGGAGAGGGTGCAGACATTAAGTACATATCACCAAAGGATAATCGTGGCGCAGGTAGCTGGGTAGGTCACAAGC
TGGACGACTACGCAGACGGGACCCGAGTGGAATTTATCGTTAAATAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(52-144)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

71.845

69.595

0.5

Multiple sequence alignment