Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACL9SD_RS13440 Genome accession   NZ_CP178914
Coordinates   2699303..2699479 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain IFST-745     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2694303..2704479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL9SD_RS13425 (ACL9SD_13425) gcvT 2694944..2696038 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  ACL9SD_RS13430 (ACL9SD_13430) - 2696632..2698311 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  ACL9SD_RS13435 (ACL9SD_13435) - 2698318..2699112 (+) 795 WP_020452164.1 YqhG family protein -
  ACL9SD_RS13440 (ACL9SD_13440) sinI 2699303..2699479 (+) 177 WP_023855184.1 anti-repressor SinI Regulator
  ACL9SD_RS13445 (ACL9SD_13445) sinR 2699513..2699848 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  ACL9SD_RS13450 (ACL9SD_13450) tasA 2699953..2700747 (-) 795 WP_048349970.1 biofilm matrix protein TasA -
  ACL9SD_RS13455 (ACL9SD_13455) sipW 2700820..2701404 (-) 585 WP_023855186.1 signal peptidase I SipW -
  ACL9SD_RS13460 (ACL9SD_13460) tapA 2701401..2702129 (-) 729 WP_023855187.1 amyloid fiber anchoring/assembly protein TapA -
  ACL9SD_RS13465 (ACL9SD_13465) - 2702407..2702727 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  ACL9SD_RS13470 (ACL9SD_13470) - 2702757..2702939 (-) 183 WP_020452171.1 YqzE family protein -
  ACL9SD_RS13475 (ACL9SD_13475) comGG 2703028..2703393 (-) 366 WP_048349968.1 competence type IV pilus minor pilin ComGG -
  ACL9SD_RS13480 (ACL9SD_13480) comGF 2703405..2703887 (-) 483 WP_230459149.1 competence type IV pilus minor pilin ComGF -
  ACL9SD_RS13485 (ACL9SD_13485) comGE 2703802..2704149 (-) 348 WP_025811161.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=1092393 ACL9SD_RS13440 WP_023855184.1 2699303..2699479(+) (sinI) [Bacillus paralicheniformis strain IFST-745]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=1092393 ACL9SD_RS13440 WP_023855184.1 2699303..2699479(+) (sinI) [Bacillus paralicheniformis strain IFST-745]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5

Multiple sequence alignment