Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACL6EO_RS15250 Genome accession   NZ_CP178718
Coordinates   3088436..3088576 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SY1154     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3083436..3093576
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL6EO_RS15225 (ACL6EO_15225) - 3083776..3084159 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  ACL6EO_RS15230 (ACL6EO_15230) comA 3084181..3084825 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  ACL6EO_RS15235 (ACL6EO_15235) comP 3084906..3087197 (-) 2292 WP_099721970.1 histidine kinase Regulator
  ACL6EO_RS15240 (ACL6EO_15240) comX 3087209..3087373 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACL6EO_RS15245 (ACL6EO_15245) - 3087373..3088284 (-) 912 WP_022553710.1 polyprenyl synthetase family protein -
  ACL6EO_RS15250 (ACL6EO_15250) degQ 3088436..3088576 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACL6EO_RS15255 (ACL6EO_15255) - 3089042..3089383 (+) 342 WP_014418765.1 hypothetical protein -
  ACL6EO_RS15260 (ACL6EO_15260) - 3089390..3090613 (-) 1224 WP_029973798.1 EAL and HDOD domain-containing protein -
  ACL6EO_RS15265 (ACL6EO_15265) - 3090743..3092209 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ACL6EO_RS15270 (ACL6EO_15270) - 3092227..3092778 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACL6EO_RS15275 (ACL6EO_15275) - 3092875..3093273 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1090948 ACL6EO_RS15250 WP_003152043.1 3088436..3088576(-) (degQ) [Bacillus velezensis strain SY1154]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1090948 ACL6EO_RS15250 WP_003152043.1 3088436..3088576(-) (degQ) [Bacillus velezensis strain SY1154]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment