Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACL6ER_RS15650 Genome accession   NZ_CP178717
Coordinates   3111096..3111236 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus inaquosorum strain SY1167     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3106096..3116236
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL6ER_RS15625 (ACL6ER_15625) - 3106438..3106818 (-) 381 WP_019259331.1 hotdog fold thioesterase -
  ACL6ER_RS15630 (ACL6ER_15630) comA 3106837..3107481 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACL6ER_RS15635 (ACL6ER_15635) comP 3107562..3109862 (-) 2301 WP_268272514.1 histidine kinase Regulator
  ACL6ER_RS15640 (ACL6ER_15640) comX 3109874..3110038 (-) 165 WP_015384519.1 competence pheromone ComX -
  ACL6ER_RS15645 (ACL6ER_15645) - 3110051..3110911 (-) 861 WP_268272513.1 polyprenyl synthetase family protein -
  ACL6ER_RS15650 (ACL6ER_15650) degQ 3111096..3111236 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACL6ER_RS15655 (ACL6ER_15655) - 3111458..3111583 (+) 126 WP_268272540.1 hypothetical protein -
  ACL6ER_RS15660 (ACL6ER_15660) - 3111696..3112064 (+) 369 WP_084991317.1 hypothetical protein -
  ACL6ER_RS15665 (ACL6ER_15665) pdeH 3112040..3113269 (-) 1230 WP_060399390.1 cyclic di-GMP phosphodiesterase -
  ACL6ER_RS15670 (ACL6ER_15670) - 3113407..3114879 (-) 1473 WP_019259336.1 nicotinate phosphoribosyltransferase -
  ACL6ER_RS15675 (ACL6ER_15675) - 3114895..3115446 (-) 552 WP_268299508.1 cysteine hydrolase family protein -
  ACL6ER_RS15680 (ACL6ER_15680) - 3115543..3115941 (-) 399 WP_019259337.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1090869 ACL6ER_RS15650 WP_003220708.1 3111096..3111236(-) (degQ) [Bacillus inaquosorum strain SY1167]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1090869 ACL6ER_RS15650 WP_003220708.1 3111096..3111236(-) (degQ) [Bacillus inaquosorum strain SY1167]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACAACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment