Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACL66B_RS16380 Genome accession   NZ_CP178617
Coordinates   3131458..3131598 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain QXKL-3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3126458..3136598
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL66B_RS16355 (ACL66B_16355) yuxO 3126801..3127181 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  ACL66B_RS16360 (ACL66B_16360) comA 3127200..3127844 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACL66B_RS16365 (ACL66B_16365) comP 3127925..3130225 (-) 2301 WP_088300729.1 histidine kinase Regulator
  ACL66B_RS16370 (ACL66B_16370) comX 3130237..3130401 (-) 165 WP_015384519.1 competence pheromone ComX -
  ACL66B_RS16375 (ACL66B_16375) - 3130414..3131274 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  ACL66B_RS16380 (ACL66B_16380) degQ 3131458..3131598 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACL66B_RS16385 (ACL66B_16385) - 3131820..3131882 (+) 63 Protein_3161 hypothetical protein -
  ACL66B_RS16390 (ACL66B_16390) - 3132061..3132429 (+) 369 WP_041850584.1 hypothetical protein -
  ACL66B_RS16395 (ACL66B_16395) pdeH 3132405..3133634 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACL66B_RS16400 (ACL66B_16400) pncB 3133771..3135243 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACL66B_RS16405 (ACL66B_16405) pncA 3135259..3135810 (-) 552 WP_043940186.1 cysteine hydrolase family protein -
  ACL66B_RS16410 (ACL66B_16410) yueI 3135907..3136305 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1090586 ACL66B_RS16380 WP_003220708.1 3131458..3131598(-) (degQ) [Bacillus subtilis strain QXKL-3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1090586 ACL66B_RS16380 WP_003220708.1 3131458..3131598(-) (degQ) [Bacillus subtilis strain QXKL-3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment