Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACKUFW_RS14825 Genome accession   NZ_CP178610
Coordinates   3001539..3001679 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GUMHT p116     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2996539..3006679
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKUFW_RS14800 (ACKUFW_14800) - 2996879..2997262 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  ACKUFW_RS14805 (ACKUFW_14805) comA 2997284..2997928 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACKUFW_RS14810 (ACKUFW_14810) comP 2998009..3000300 (-) 2292 WP_039254056.1 histidine kinase Regulator
  ACKUFW_RS14815 (ACKUFW_14815) comX 3000312..3000476 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACKUFW_RS14820 (ACKUFW_14820) - 3000476..3001387 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  ACKUFW_RS14825 (ACKUFW_14825) degQ 3001539..3001679 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACKUFW_RS14830 (ACKUFW_14830) - 3002145..3002486 (+) 342 WP_202735689.1 hypothetical protein -
  ACKUFW_RS14835 (ACKUFW_14835) - 3002493..3003714 (-) 1222 Protein_2854 EAL and HDOD domain-containing protein -
  ACKUFW_RS14840 (ACKUFW_14840) - 3003844..3005310 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACKUFW_RS14845 (ACKUFW_14845) - 3005328..3005879 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  ACKUFW_RS14850 (ACKUFW_14850) - 3005976..3006374 (-) 399 WP_202735690.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1090500 ACKUFW_RS14825 WP_003152043.1 3001539..3001679(-) (degQ) [Bacillus velezensis strain GUMHT p116]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1090500 ACKUFW_RS14825 WP_003152043.1 3001539..3001679(-) (degQ) [Bacillus velezensis strain GUMHT p116]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment