Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   ACAM23_RS02890 Genome accession   NZ_AP031394
Coordinates   540643..540792 (+) Length   49 a.a.
NCBI ID   WP_001820573.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 16P28     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 538971..539776 540643..540792 flank 867


Gene organization within MGE regions


Location: 538971..540792
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACAM23_RS02875 - 538971..539776 (+) 806 Protein_566 IS5 family transposase -
  ACAM23_RS02880 (SPNE16P28_05630) blpM 539926..540180 (+) 255 WP_000379877.1 two-peptide bacteriocin subunit BlpM -
  ACAM23_RS02885 (SPNE16P28_05640) blpN 540196..540399 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  ACAM23_RS02890 (SPNE16P28_05650) cipB 540643..540792 (+) 150 WP_001820573.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5150.91 Da        Isoelectric Point: 3.9133

>NTDB_id=108952 ACAM23_RS02890 WP_001820573.1 540643..540792(+) (cipB) [Streptococcus pneumoniae strain 16P28]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=108952 ACAM23_RS02890 WP_001820573.1 540643..540792(+) (cipB) [Streptococcus pneumoniae strain 16P28]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment