Detailed information NTG1089400

Bioinformatically predicted

Overview

• Name: tfoS
• Type: Regulator
• Locus tag: ACLRDL_RS10960
• Genome accession: NZ_CP178387
• Coordinates: 2414768..2414893 (-)
• Length: 41 a.a.
• NCBI ID: WP_413084192.1
• Uniprot ID: -
• Organism: Vibrio cholerae isolate CTMA_1842
• Function: chitin sensor (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	2413598..2414775	2414768..2414893	flank	-7

Gene organization within MGE regions

Location: 2413598..2414893

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACLRDL_RS10955 (ACLRDL_10955)	-	2413598..2414775 (+)	1178	WP_086010879.1	IS3-like element ISVch4 family transposase	-
ACLRDL_RS10960 (ACLRDL_10960)	tfoS	2414768..2414893 (-)	126	WP_413084192.1	hypothetical protein	Regulator

Sequence

Protein

• Length: 41 a.a.
• Molecular weight: 4675.71 Da
• Isoelectric Point: 6.9673

>NTDB_id=1089400 ACLRDL_RS10960 WP_413084192.1 2414768..2414893(-) (tfoS) [Vibrio cholerae isolate CTMA_1842]
MFRTLLYGCLLNILIPSLVLALDKSMSIFYPLPIQEHVVVN

Nucleotide

• Length: 126 bp

>NTDB_id=1089400 ACLRDL_RS10960 WP_413084192.1 2414768..2414893(-) (tfoS) [Vibrio cholerae isolate CTMA_1842]
GTGTTTCGCACATTGTTGTATGGCTGCTTGCTCAATATCCTGATCCCATCCTTGGTATTGGCATTAGATAAATCTATGTC
TATTTTCTATCCTTTGCCCATTCAAGAGCATGTAGTGGTCAACTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
tfoS	Vibrio cholerae O1 biovar El Tor strain E7946	97.297	90.244	0.878