Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   ACLF6N_RS13660 Genome accession   NZ_CP177279
Coordinates   2509602..2510012 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain KFRI-P74     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2504967..2532889 2509602..2510012 within 0


Gene organization within MGE regions


Location: 2504967..2532889
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLF6N_RS13635 (ACLF6N_13635) yqeF 2505134..2505865 (-) 732 WP_412052439.1 SGNH/GDSL hydrolase family protein -
  ACLF6N_RS13640 (ACLF6N_13640) cwlH 2506117..2506869 (-) 753 WP_021480067.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  ACLF6N_RS13645 (ACLF6N_13645) yqeD 2507056..2507682 (+) 627 WP_046160610.1 TVP38/TMEM64 family protein -
  ACLF6N_RS13650 (ACLF6N_13650) gnd 2507702..2508595 (-) 894 WP_046160611.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  ACLF6N_RS13655 (ACLF6N_13655) yqeB 2508847..2509569 (+) 723 WP_014480321.1 hypothetical protein -
  ACLF6N_RS13660 (ACLF6N_13660) nucA/comI 2509602..2510012 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  ACLF6N_RS13665 (ACLF6N_13665) sigK 2510208..2510936 (+) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  ACLF6N_RS13670 (ACLF6N_13670) - 2510936..2511034 (+) 99 WP_031600702.1 hypothetical protein -
  ACLF6N_RS13675 (ACLF6N_13675) - 2511031..2511243 (-) 213 Protein_2646 recombinase family protein -
  ACLF6N_RS13680 (ACLF6N_13680) fumC 2511462..2512850 (-) 1389 WP_014480325.1 class II fumarate hydratase -
  ACLF6N_RS13685 (ACLF6N_13685) - 2513017..2513907 (+) 891 WP_014480326.1 LysR family transcriptional regulator -
  ACLF6N_RS13690 (ACLF6N_13690) - 2514849..2515244 (+) 396 WP_046160622.1 VOC family protein -
  ACLF6N_RS13695 (ACLF6N_13695) - 2515984..2517111 (-) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  ACLF6N_RS13700 (ACLF6N_13700) - 2517293..2518126 (+) 834 Protein_2651 ribonuclease YeeF family protein -
  ACLF6N_RS13705 (ACLF6N_13705) - 2518512..2519219 (+) 708 WP_014480330.1 hypothetical protein -
  ACLF6N_RS13710 (ACLF6N_13710) - 2519233..2519520 (+) 288 WP_014480331.1 hypothetical protein -
  ACLF6N_RS13715 (ACLF6N_13715) - 2519923..2520363 (+) 441 WP_014480332.1 SMI1/KNR4 family protein -
  ACLF6N_RS13720 (ACLF6N_13720) - 2520462..2520914 (+) 453 WP_129134003.1 SMI1/KNR4 family protein -
  ACLF6N_RS13725 (ACLF6N_13725) cdiI 2521011..2521370 (+) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  ACLF6N_RS13730 (ACLF6N_13730) - 2521475..2521954 (+) 480 WP_224588637.1 hypothetical protein -
  ACLF6N_RS13735 (ACLF6N_13735) - 2522262..2522465 (-) 204 WP_123772462.1 hypothetical protein -
  ACLF6N_RS13740 (ACLF6N_13740) - 2522554..2522787 (+) 234 WP_224588641.1 hypothetical protein -
  ACLF6N_RS13745 (ACLF6N_13745) atxG 2523055..2523632 (+) 578 Protein_2660 suppressor of fused domain protein -
  ACLF6N_RS13750 (ACLF6N_13750) - 2523742..2524032 (+) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  ACLF6N_RS13755 (ACLF6N_13755) - 2524940..2525106 (-) 167 Protein_2662 peptidoglycan-binding domain-containing protein -
  ACLF6N_RS13760 (ACLF6N_13760) - 2525281..2525367 (+) 87 WP_072592549.1 putative holin-like toxin -
  ACLF6N_RS13765 (ACLF6N_13765) - 2525654..2526129 (-) 476 Protein_2664 phage tail tube protein -
  ACLF6N_RS13770 (ACLF6N_13770) terS 2526089..2526653 (-) 565 Protein_2665 phage terminase small subunit -
  ACLF6N_RS13775 (ACLF6N_13775) - 2526780..2527085 (+) 306 WP_123772463.1 hypothetical protein -
  ACLF6N_RS13780 (ACLF6N_13780) istA 2527658..2529205 (+) 1548 WP_014480339.1 IS21 family transposase -
  ACLF6N_RS13785 (ACLF6N_13785) istB 2529202..2529960 (+) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  ACLF6N_RS13790 (ACLF6N_13790) - 2529915..2530442 (-) 528 WP_412052440.1 hypothetical protein -
  ACLF6N_RS13795 (ACLF6N_13795) - 2531059..2531325 (+) 267 WP_033881358.1 hypothetical protein -
  ACLF6N_RS13800 (ACLF6N_13800) - 2531464..2531616 (-) 153 WP_049832653.1 XtrA/YqaO family protein -
  ACLF6N_RS13805 (ACLF6N_13805) - 2531699..2531821 (-) 123 Protein_2672 RusA family crossover junction endodeoxyribonuclease -
  ACLF6N_RS13810 (ACLF6N_13810) - 2531784..2532032 (-) 249 Protein_2673 hypothetical protein -
  ACLF6N_RS13815 (ACLF6N_13815) - 2532177..2532407 (-) 231 WP_224588644.1 hypothetical protein -
  ACLF6N_RS13820 (ACLF6N_13820) - 2532716..2532889 (-) 174 WP_326043410.1 hypothetical protein -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=1086558 ACLF6N_RS13660 WP_009967785.1 2509602..2510012(-) (nucA/comI) [Bacillus subtilis strain KFRI-P74]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=1086558 ACLF6N_RS13660 WP_009967785.1 2509602..2510012(-) (nucA/comI) [Bacillus subtilis strain KFRI-P74]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment