Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACLIMI_RS17760 Genome accession   NZ_CP177045
Coordinates   3338981..3339121 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain MPB11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3333981..3344121
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACLIMI_RS17735 (ACLIMI_17735) - 3334253..3334642 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  ACLIMI_RS17740 (ACLIMI_17740) comA 3334659..3335297 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  ACLIMI_RS17745 (ACLIMI_17745) - 3335384..3337704 (-) 2321 Protein_3443 ATP-binding protein -
  ACLIMI_RS17750 (ACLIMI_17750) comX 3337744..3337908 (-) 165 WP_011198251.1 competence pheromone ComX -
  ACLIMI_RS17755 (ACLIMI_17755) - 3337923..3338792 (-) 870 WP_011198252.1 polyprenyl synthetase family protein -
  ACLIMI_RS17760 (ACLIMI_17760) degQ 3338981..3339121 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  ACLIMI_RS17765 (ACLIMI_17765) - 3339607..3339954 (+) 348 WP_009329512.1 hypothetical protein -
  ACLIMI_RS17770 (ACLIMI_17770) - 3339997..3341217 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  ACLIMI_RS17775 (ACLIMI_17775) - 3341396..3342865 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  ACLIMI_RS17780 (ACLIMI_17780) - 3342883..3343434 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  ACLIMI_RS17785 (ACLIMI_17785) - 3343619..3344020 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=1085224 ACLIMI_RS17760 WP_003184860.1 3338981..3339121(-) (degQ) [Bacillus licheniformis strain MPB11]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1085224 ACLIMI_RS17760 WP_003184860.1 3338981..3339121(-) (degQ) [Bacillus licheniformis strain MPB11]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment