Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACJX3V_RS11890 Genome accession   NZ_CP176523
Coordinates   2460341..2460514 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain MEPW12     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2455341..2465514
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJX3V_RS11875 gcvT 2456158..2457258 (-) 1101 WP_207579557.1 glycine cleavage system aminomethyltransferase GcvT -
  ACJX3V_RS11880 - 2457682..2459352 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  ACJX3V_RS11885 - 2459370..2460164 (+) 795 WP_003153106.1 YqhG family protein -
  ACJX3V_RS11890 sinI 2460341..2460514 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJX3V_RS11895 sinR 2460548..2460883 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJX3V_RS11900 tasA 2460931..2461716 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACJX3V_RS11905 sipW 2461780..2462364 (-) 585 WP_046559873.1 signal peptidase I SipW -
  ACJX3V_RS11910 tapA 2462336..2463007 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  ACJX3V_RS11915 - 2463266..2463595 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACJX3V_RS11920 - 2463635..2463814 (-) 180 WP_003153093.1 YqzE family protein -
  ACJX3V_RS11925 comGG 2463871..2464248 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJX3V_RS11930 comGF 2464249..2464644 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACJX3V_RS11935 comGE 2464658..2464972 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACJX3V_RS11940 comGD 2464956..2465393 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1080612 ACJX3V_RS11890 WP_003153105.1 2460341..2460514(+) (sinI) [Bacillus amyloliquefaciens strain MEPW12]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1080612 ACJX3V_RS11890 WP_003153105.1 2460341..2460514(+) (sinI) [Bacillus amyloliquefaciens strain MEPW12]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment