Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACKWCM_RS15025 Genome accession   NZ_CP176416
Coordinates   2927103..2927243 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain GUCCb3-7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2922103..2932243
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKWCM_RS15000 (ACKWCM_15000) - 2922437..2922826 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  ACKWCM_RS15005 (ACKWCM_15005) comA 2922850..2923491 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  ACKWCM_RS15010 (ACKWCM_15010) comP 2923572..2925863 (-) 2292 WP_024425943.1 ATP-binding protein Regulator
  ACKWCM_RS15015 (ACKWCM_15015) comX 2925877..2926050 (-) 174 WP_024425944.1 competence pheromone ComX -
  ACKWCM_RS15020 (ACKWCM_15020) - 2926028..2926951 (-) 924 WP_024425945.1 polyprenyl synthetase family protein -
  ACKWCM_RS15025 (ACKWCM_15025) degQ 2927103..2927243 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACKWCM_RS15030 (ACKWCM_15030) - 2927749..2928105 (+) 357 WP_024425946.1 hypothetical protein -
  ACKWCM_RS15035 (ACKWCM_15035) - 2928141..2929367 (-) 1227 WP_024425947.1 EAL and HDOD domain-containing protein -
  ACKWCM_RS15040 (ACKWCM_15040) - 2929505..2930977 (-) 1473 WP_024425948.1 nicotinate phosphoribosyltransferase -
  ACKWCM_RS15045 (ACKWCM_15045) - 2930995..2931546 (-) 552 WP_149126319.1 cysteine hydrolase family protein -
  ACKWCM_RS15050 (ACKWCM_15050) - 2931607..2932014 (-) 408 WP_024423329.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1079988 ACKWCM_RS15025 WP_003213123.1 2927103..2927243(-) (degQ) [Bacillus safensis strain GUCCb3-7]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1079988 ACKWCM_RS15025 WP_003213123.1 2927103..2927243(-) (degQ) [Bacillus safensis strain GUCCb3-7]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment