Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   ACKWCM_RS08945 Genome accession   NZ_CP176416
Coordinates   1790200..1790580 (+) Length   126 a.a.
NCBI ID   WP_065214465.1    Uniprot ID   -
Organism   Bacillus safensis strain GUCCb3-7     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1745510..1794993 1790200..1790580 within 0


Gene organization within MGE regions


Location: 1745510..1794993
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKWCM_RS08675 (ACKWCM_08675) - 1745510..1745812 (-) 303 WP_311165352.1 tyrosine-type recombinase/integrase -
  ACKWCM_RS08680 (ACKWCM_08680) - 1745869..1746063 (+) 195 WP_373393563.1 XtrA/YqaO family protein -
  ACKWCM_RS08685 (ACKWCM_08685) - 1746236..1747303 (+) 1068 WP_311165355.1 patatin-like phospholipase family protein -
  ACKWCM_RS08690 (ACKWCM_08690) - 1747607..1747753 (+) 147 WP_311165356.1 hypothetical protein -
  ACKWCM_RS08695 (ACKWCM_08695) - 1747820..1748212 (+) 393 WP_311165357.1 DNA methyltransferase -
  ACKWCM_RS08700 (ACKWCM_08700) - 1748169..1748387 (+) 219 WP_311165358.1 site-specific DNA-methyltransferase -
  ACKWCM_RS08705 (ACKWCM_08705) - 1748507..1748845 (+) 339 WP_311165359.1 hypothetical protein -
  ACKWCM_RS08710 (ACKWCM_08710) - 1748937..1749059 (+) 123 WP_311165360.1 hypothetical protein -
  ACKWCM_RS08715 (ACKWCM_08715) - 1749075..1749539 (+) 465 WP_311165361.1 hypothetical protein -
  ACKWCM_RS08720 (ACKWCM_08720) - 1749695..1750195 (+) 501 WP_311165362.1 hypothetical protein -
  ACKWCM_RS08725 (ACKWCM_08725) - 1750267..1750830 (+) 564 WP_311165363.1 hypothetical protein -
  ACKWCM_RS08730 (ACKWCM_08730) terS 1750984..1751701 (+) 718 Protein_1671 phage terminase small subunit -
  ACKWCM_RS08735 (ACKWCM_08735) - 1751701..1752273 (+) 573 WP_396133867.1 PBSX family phage terminase large subunit -
  ACKWCM_RS08740 (ACKWCM_08740) - 1752281..1752505 (+) 225 WP_396133868.1 phage terminase large subunit -
  ACKWCM_RS08745 (ACKWCM_08745) - 1752510..1752846 (+) 337 Protein_1674 terminase large subunit -
  ACKWCM_RS08750 (ACKWCM_08750) - 1752922..1754048 (+) 1127 Protein_1675 phage portal protein -
  ACKWCM_RS08755 (ACKWCM_08755) - 1754019..1754495 (-) 477 WP_373393560.1 phage tail assembly chaperone -
  ACKWCM_RS08760 (ACKWCM_08760) - 1754891..1755184 (-) 294 Protein_1677 phage tail tube protein -
  ACKWCM_RS08765 (ACKWCM_08765) - 1755176..1755691 (+) 516 Protein_1678 peptidoglycan-binding protein -
  ACKWCM_RS08770 (ACKWCM_08770) - 1755813..1756133 (-) 321 WP_311165364.1 hypothetical protein -
  ACKWCM_RS08775 (ACKWCM_08775) - 1756276..1758081 (+) 1806 WP_311165365.1 S8 family peptidase -
  ACKWCM_RS08780 (ACKWCM_08780) - 1758258..1759208 (+) 951 WP_311165366.1 S8 family peptidase -
  ACKWCM_RS08785 (ACKWCM_08785) - 1759495..1759647 (+) 153 WP_311165367.1 hypothetical protein -
  ACKWCM_RS08790 (ACKWCM_08790) - 1759678..1759914 (+) 237 WP_311165368.1 hypothetical protein -
  ACKWCM_RS08795 (ACKWCM_08795) - 1759886..1760287 (+) 402 WP_311165369.1 hypothetical protein -
  ACKWCM_RS08800 (ACKWCM_08800) - 1760253..1760879 (+) 627 WP_311165370.1 hypothetical protein -
  ACKWCM_RS08805 (ACKWCM_08805) - 1760962..1761150 (-) 189 WP_311165371.1 BlaI/MecI/CopY family transcriptional regulator -
  ACKWCM_RS08810 (ACKWCM_08810) - 1761231..1762067 (+) 837 WP_311165372.1 SMI1/KNR4 family protein -
  ACKWCM_RS08815 (ACKWCM_08815) - 1762270..1763376 (+) 1107 WP_167753078.1 Rap family tetratricopeptide repeat protein -
  ACKWCM_RS08820 (ACKWCM_08820) - 1764819..1765003 (+) 185 Protein_1689 nuclease -
  ACKWCM_RS08825 (ACKWCM_08825) - 1765169..1765558 (+) 390 WP_311165373.1 hypothetical protein -
  ACKWCM_RS08830 (ACKWCM_08830) - 1765839..1766642 (+) 804 WP_311165374.1 hypothetical protein -
  ACKWCM_RS08835 (ACKWCM_08835) - 1767425..1767559 (+) 135 WP_254966822.1 hypothetical protein -
  ACKWCM_RS08840 (ACKWCM_08840) - 1767649..1769577 (+) 1929 WP_341320049.1 T7SS effector LXG polymorphic toxin -
  ACKWCM_RS08845 (ACKWCM_08845) - 1769585..1770067 (+) 483 WP_341320048.1 immunity protein YezG family protein -
  ACKWCM_RS08850 (ACKWCM_08850) - 1770155..1770616 (-) 462 WP_044335609.1 macro domain-containing protein -
  ACKWCM_RS08855 (ACKWCM_08855) - 1770844..1771425 (+) 582 WP_034621968.1 undecaprenyl-diphosphatase -
  ACKWCM_RS08860 (ACKWCM_08860) - 1771477..1771848 (-) 372 WP_056766571.1 iron chaperone -
  ACKWCM_RS08865 (ACKWCM_08865) - 1772391..1773503 (+) 1113 WP_024425110.1 tetratricopeptide repeat protein -
  ACKWCM_RS08870 (ACKWCM_08870) - 1773959..1774192 (+) 234 WP_024425111.1 hypothetical protein -
  ACKWCM_RS08875 (ACKWCM_08875) - 1774233..1774928 (-) 696 WP_024427061.1 YoaK family protein -
  ACKWCM_RS08880 (ACKWCM_08880) - 1774996..1776828 (-) 1833 WP_311165376.1 DNA ligase D -
  ACKWCM_RS08885 (ACKWCM_08885) - 1776944..1777792 (+) 849 WP_024425113.1 Ku protein -
  ACKWCM_RS08890 (ACKWCM_08890) - 1778003..1778446 (-) 444 WP_311165377.1 DUF2188 domain-containing protein -
  ACKWCM_RS08895 (ACKWCM_08895) - 1778612..1779085 (+) 474 WP_311165378.1 VOC family protein -
  ACKWCM_RS08900 (ACKWCM_08900) - 1779134..1779547 (+) 414 WP_025093258.1 Rrf2 family transcriptional regulator -
  ACKWCM_RS08905 (ACKWCM_08905) - 1779649..1780500 (+) 852 WP_098676909.1 SDR family oxidoreductase -
  ACKWCM_RS08910 (ACKWCM_08910) - 1780655..1781563 (+) 909 WP_311165379.1 DMT family transporter -
  ACKWCM_RS08915 (ACKWCM_08915) - 1781576..1781767 (-) 192 WP_025093255.1 hypothetical protein -
  ACKWCM_RS08920 (ACKWCM_08920) - 1781878..1784094 (+) 2217 WP_311165380.1 RNA ligase -
  ACKWCM_RS08925 (ACKWCM_08925) - 1784159..1784869 (+) 711 WP_025093253.1 DUF421 domain-containing protein -
  ACKWCM_RS08930 (ACKWCM_08930) - 1785097..1785675 (+) 579 WP_024427074.1 TetR/AcrR family transcriptional regulator -
  ACKWCM_RS08935 (ACKWCM_08935) - 1785697..1788840 (+) 3144 WP_197172870.1 bifunctional cytochrome P450/NADPH--P450 reductase -
  ACKWCM_RS08940 (ACKWCM_08940) - 1789034..1789942 (+) 909 WP_024425124.1 serine protease -
  ACKWCM_RS08945 (ACKWCM_08945) nucA/comI 1790200..1790580 (+) 381 WP_065214465.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  ACKWCM_RS08950 (ACKWCM_08950) - 1790726..1791574 (+) 849 WP_024427077.1 STAS domain-containing protein -
  ACKWCM_RS08955 (ACKWCM_08955) - 1791607..1792149 (-) 543 WP_024425127.1 IseA DL-endopeptidase inhibitor family protein -
  ACKWCM_RS08960 (ACKWCM_08960) - 1792446..1792892 (+) 447 WP_149126619.1 hypothetical protein -
  ACKWCM_RS08965 (ACKWCM_08965) lexA 1792938..1793558 (-) 621 WP_024425129.1 transcriptional repressor LexA -
  ACKWCM_RS08970 (ACKWCM_08970) yneA 1793717..1794028 (+) 312 WP_024425130.1 cell division suppressor protein YneA -
  ACKWCM_RS08975 (ACKWCM_08975) - 1794046..1794693 (+) 648 WP_025093247.1 recombinase family protein -
  ACKWCM_RS08980 (ACKWCM_08980) - 1794763..1794993 (+) 231 WP_024425132.1 DUF896 domain-containing protein -

Sequence


Protein


Download         Length: 126 a.a.        Molecular weight: 13833.49 Da        Isoelectric Point: 7.9051

>NTDB_id=1079970 ACKWCM_RS08945 WP_065214465.1 1790200..1790580(+) (nucA/comI) [Bacillus safensis strain GUCCb3-7]
MGTLFGGFGEKQAAKGADRYDHVVQFPKERYPETGSHIQEAIRKGHSDVCTIDRNGADARRQESLKGIPTKPGFDRDEWP
MAVCLEGGKGASVQYVSPSDNRGAGSWVGHQISEFPDGKRILFIVK

Nucleotide


Download         Length: 381 bp        

>NTDB_id=1079970 ACKWCM_RS08945 WP_065214465.1 1790200..1790580(+) (nucA/comI) [Bacillus safensis strain GUCCb3-7]
ATGGGCACGTTGTTTGGCGGATTTGGAGAGAAGCAGGCAGCAAAAGGGGCTGATCGATATGATCATGTCGTTCAATTTCC
AAAGGAAAGGTACCCTGAAACAGGCAGTCATATTCAAGAAGCCATTCGAAAAGGGCATTCAGATGTGTGTACCATTGACC
GAAATGGAGCAGATGCCCGCAGGCAAGAATCATTAAAAGGAATTCCGACAAAACCTGGCTTTGACCGGGATGAATGGCCA
ATGGCGGTTTGTCTTGAGGGAGGAAAAGGCGCAAGCGTTCAATATGTCAGTCCATCTGATAATAGGGGGGCAGGCTCATG
GGTCGGGCATCAAATCAGCGAGTTTCCTGATGGGAAAAGAATATTATTCATTGTGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

57.983

94.444

0.548


Multiple sequence alignment