Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   BSUA_RS17195 Genome accession   NZ_CP007800
Coordinates   3228620..3228787 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3223620..3233787
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSUA_RS17165 (BSUA_03383) mrpE 3224015..3224491 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  BSUA_RS17170 (BSUA_03384) mrpF 3224491..3224775 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  BSUA_RS17175 (BSUA_03385) mnhG 3224759..3225133 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  BSUA_RS17180 (BSUA_03386) yuxO 3225172..3225552 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  BSUA_RS17185 (BSUA_03387) comA 3225571..3226215 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSUA_RS17190 (BSUA_03388) comP 3226296..3228605 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  BSUA_RS17195 (BSUA_03389) comX 3228620..3228787 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  BSUA_RS17200 (BSUA_03390) comQ 3228775..3229674 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  BSUA_RS17205 (BSUA_03391) degQ 3229859..3229999 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSUA_RS22945 - 3230221..3230346 (+) 126 WP_003228793.1 hypothetical protein -
  BSUA_RS17210 (BSUA_03392) - 3230460..3230828 (+) 369 WP_003243784.1 hypothetical protein -
  BSUA_RS17215 (BSUA_03393) pdeH 3230804..3232033 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BSUA_RS17220 (BSUA_03394) pncB 3232170..3233642 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=107987 BSUA_RS17195 WP_003242801.1 3228620..3228787(-) (comX) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=107987 BSUA_RS17195 WP_003242801.1 3228620..3228787(-) (comX) [Bacillus subtilis subsp. subtilis str. JH642 substr. AG174 strain JH642]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1