Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   ACKKE8_RS11025 Genome accession   NZ_CP176370
Coordinates   2128376..2128804 (-) Length   142 a.a.
NCBI ID   WP_409178196.1    Uniprot ID   -
Organism   Brevibacillus fortis strain LJQJ21     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2101054..2128804 2128376..2128804 within 0


Gene organization within MGE regions


Location: 2101054..2128804
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKKE8_RS10875 (ACKKE8_10875) - 2101054..2101566 (+) 513 WP_409178181.1 hypothetical protein -
  ACKKE8_RS10880 (ACKKE8_10880) - 2101841..2102737 (+) 897 WP_409178182.1 helix-turn-helix transcriptional regulator -
  ACKKE8_RS10885 (ACKKE8_10885) - 2102817..2103668 (+) 852 WP_409178183.1 DUF2785 domain-containing protein -
  ACKKE8_RS10890 (ACKKE8_10890) - 2104056..2104733 (+) 678 WP_409178184.1 GNAT family N-acetyltransferase -
  ACKKE8_RS10910 (ACKKE8_10910) - 2110819..2111787 (-) 969 WP_409179093.1 endonuclease/exonuclease/phosphatase family protein -
  ACKKE8_RS10915 (ACKKE8_10915) - 2111789..2112406 (-) 618 WP_409178185.1 hypothetical protein -
  ACKKE8_RS10920 (ACKKE8_10920) - 2112673..2112756 (+) 84 Protein_2069 RCC1-like domain-containing protein -
  ACKKE8_RS10925 (ACKKE8_10925) - 2113019..2113810 (+) 792 WP_409178186.1 oxalate:formate antiporter -
  ACKKE8_RS10930 (ACKKE8_10930) - 2114108..2114380 (-) 273 WP_409179094.1 HU family DNA-binding protein -
  ACKKE8_RS10935 (ACKKE8_10935) - 2114830..2115273 (-) 444 WP_409178187.1 DUF2269 family protein -
  ACKKE8_RS10940 (ACKKE8_10940) - 2115276..2115629 (-) 354 WP_390233010.1 ASCH domain-containing protein -
  ACKKE8_RS10945 (ACKKE8_10945) - 2115910..2116785 (-) 876 WP_409178188.1 LysR family transcriptional regulator -
  ACKKE8_RS10950 (ACKKE8_10950) - 2116902..2117327 (+) 426 WP_409179095.1 SgcJ/EcaC family oxidoreductase -
  ACKKE8_RS10955 (ACKKE8_10955) - 2118166..2119614 (+) 1449 WP_409175469.1 IS110 family transposase -
  ACKKE8_RS10960 (ACKKE8_10960) - 2119722..2120381 (+) 660 WP_409175470.1 uridine kinase -
  ACKKE8_RS10965 (ACKKE8_10965) - 2120794..2121348 (+) 555 WP_409178189.1 GNAT family N-acetyltransferase -
  ACKKE8_RS10970 (ACKKE8_10970) - 2121549..2121923 (+) 375 Protein_2079 sigma-70 family RNA polymerase sigma factor -
  ACKKE8_RS10975 (ACKKE8_10975) - 2122259..2122495 (+) 237 Protein_2080 hypothetical protein -
  ACKKE8_RS10980 (ACKKE8_10980) - 2122508..2122648 (+) 141 WP_409179096.1 XkdX family protein -
  ACKKE8_RS10985 (ACKKE8_10985) - 2123261..2123800 (+) 540 WP_409178190.1 matrixin family metalloprotease -
  ACKKE8_RS10990 (ACKKE8_10990) - 2123844..2124440 (+) 597 WP_409178191.1 hypothetical protein -
  ACKKE8_RS10995 (ACKKE8_10995) - 2124580..2124669 (+) 90 WP_409178192.1 SOS response-associated peptidase family protein -
  ACKKE8_RS11000 (ACKKE8_11000) - 2124876..2125718 (-) 843 WP_409178193.1 discoidin domain-containing protein -
  ACKKE8_RS11005 (ACKKE8_11005) - 2126010..2126300 (+) 291 Protein_2086 sigma-70 family RNA polymerase sigma factor -
  ACKKE8_RS11010 (ACKKE8_11010) - 2126768..2126944 (+) 177 WP_409178194.1 XkdX family protein -
  ACKKE8_RS11015 (ACKKE8_11015) - 2127575..2127757 (+) 183 WP_409178195.1 hypothetical protein -
  ACKKE8_RS11020 (ACKKE8_11020) - 2127983..2128285 (+) 303 WP_409179097.1 WGxxGxxG family protein -
  ACKKE8_RS11025 (ACKKE8_11025) nucA/comI 2128376..2128804 (-) 429 WP_409178196.1 DNA-entry nuclease Machinery gene

Sequence

Protein


Download         Length: 142 a.a.        Molecular weight: 15532.74 Da        Isoelectric Point: 6.2285

>NTDB_id=1079794 ACKKE8_RS11025 WP_409178196.1 2128376..2128804(-) (nucA/comI) [Brevibacillus fortis strain LJQJ21]
MTQKKMLMLIVVLLIGAAYLFGLVPIKNKTVSNQNVDHTIVFPSDRYPQTAKHIEEAIASGKSAICTIDRDGADENRVES
LNGIPTKKGYDRDEWPMALCAEGGTGAHIKYISPSDNRGAGSWISNQLEDFPDGTKVEIVVK

Nucleotide


Download         Length: 429 bp        

>NTDB_id=1079794 ACKKE8_RS11025 WP_409178196.1 2128376..2128804(-) (nucA/comI) [Brevibacillus fortis strain LJQJ21]
ATGACACAGAAAAAAATGCTGATGTTGATTGTGGTGCTGCTGATCGGCGCCGCCTATCTTTTTGGACTTGTGCCAATAAA
GAACAAAACAGTCAGCAACCAAAACGTAGACCATACGATTGTTTTTCCGTCTGATAGATACCCTCAGACTGCAAAGCATA
TCGAAGAAGCAATTGCCTCTGGGAAGTCAGCTATATGCACAATTGACCGCGATGGAGCAGATGAAAATCGTGTAGAATCA
CTAAATGGCATTCCAACAAAAAAGGGGTATGATCGAGATGAATGGCCAATGGCCTTGTGTGCAGAGGGTGGAACAGGGGC
ACATATCAAATACATATCACCTTCAGATAATCGAGGAGCTGGATCTTGGATATCCAATCAATTAGAGGATTTTCCAGACG
GAACAAAAGTTGAAATCGTGGTCAAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(45-140)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

61.739

80.986

0.5

Multiple sequence alignment