Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ACKPXQ_RS01955 Genome accession   NZ_CP176038
Coordinates   391487..391606 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain A4     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 386487..396606
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKPXQ_RS01940 (ACKPXQ_01940) - 388099..388782 (+) 684 WP_014416901.1 response regulator transcription factor -
  ACKPXQ_RS01945 (ACKPXQ_01945) - 388769..390196 (+) 1428 WP_100261600.1 HAMP domain-containing sensor histidine kinase -
  ACKPXQ_RS01950 (ACKPXQ_01950) rapC 390355..391503 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  ACKPXQ_RS01955 (ACKPXQ_01955) phrC 391487..391606 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACKPXQ_RS01960 (ACKPXQ_01960) - 391758..391868 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  ACKPXQ_RS01965 (ACKPXQ_01965) - 391948..393312 (-) 1365 WP_110085395.1 aspartate kinase -
  ACKPXQ_RS01970 (ACKPXQ_01970) ceuB 393725..394678 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  ACKPXQ_RS01975 (ACKPXQ_01975) - 394668..395615 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACKPXQ_RS01980 (ACKPXQ_01980) - 395609..396367 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1079486 ACKPXQ_RS01955 WP_003156334.1 391487..391606(+) (phrC) [Bacillus velezensis strain A4]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1079486 ACKPXQ_RS01955 WP_003156334.1 391487..391606(+) (phrC) [Bacillus velezensis strain A4]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment