Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACJJTF_RS15010 Genome accession   NZ_CP175908
Coordinates   3035911..3036051 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SJ22     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3030911..3041051
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJJTF_RS14990 (ACJJTF_14990) - 3031208..3031591 (-) 384 WP_053574130.1 hotdog fold thioesterase -
  ACJJTF_RS14995 (ACJJTF_14995) comA 3031613..3032257 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACJJTF_RS15000 (ACJJTF_15000) comP 3032338..3034641 (-) 2304 WP_040238945.1 histidine kinase Regulator
  ACJJTF_RS15005 (ACJJTF_15005) comQ 3034794..3035780 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACJJTF_RS15010 (ACJJTF_15010) degQ 3035911..3036051 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACJJTF_RS15015 (ACJJTF_15015) - 3036514..3036855 (+) 342 WP_015418107.1 hypothetical protein -
  ACJJTF_RS15020 (ACJJTF_15020) - 3036862..3038124 (-) 1263 WP_409017987.1 EAL and HDOD domain-containing protein -
  ACJJTF_RS15025 (ACJJTF_15025) - 3038254..3039720 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  ACJJTF_RS15030 (ACJJTF_15030) - 3039738..3040289 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACJJTF_RS15035 (ACJJTF_15035) - 3040386..3040784 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1079086 ACJJTF_RS15010 WP_003152043.1 3035911..3036051(-) (degQ) [Bacillus velezensis strain SJ22]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1079086 ACJJTF_RS15010 WP_003152043.1 3035911..3036051(-) (degQ) [Bacillus velezensis strain SJ22]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment