Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACJJTF_RS02015 Genome accession   NZ_CP175908
Coordinates   401693..401812 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus velezensis strain SJ22     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 396693..406812
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJJTF_RS02000 (ACJJTF_02000) - 398305..398988 (+) 684 WP_007410267.1 response regulator transcription factor -
  ACJJTF_RS02005 (ACJJTF_02005) - 398975..400408 (+) 1434 WP_015416810.1 HAMP domain-containing sensor histidine kinase -
  ACJJTF_RS02010 (ACJJTF_02010) rapC 400561..401709 (+) 1149 WP_033575082.1 Rap family tetratricopeptide repeat protein Regulator
  ACJJTF_RS02015 (ACJJTF_02015) phrC 401693..401812 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACJJTF_RS02020 (ACJJTF_02020) - 401959..402069 (-) 111 WP_370529518.1 YjcZ family sporulation protein -
  ACJJTF_RS02025 (ACJJTF_02025) - 402149..403513 (-) 1365 WP_033575080.1 aspartate kinase -
  ACJJTF_RS02030 (ACJJTF_02030) ceuB 403927..404880 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  ACJJTF_RS02035 (ACJJTF_02035) - 404870..405817 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACJJTF_RS02040 (ACJJTF_02040) - 405811..406569 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=1079034 ACJJTF_RS02015 WP_033575081.1 401693..401812(+) (phrC) [Bacillus velezensis strain SJ22]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1079034 ACJJTF_RS02015 WP_033575081.1 401693..401812(+) (phrC) [Bacillus velezensis strain SJ22]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment