Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACKFA7_RS01830 Genome accession   NZ_CP175553
Coordinates   360559..360678 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain 4-9-2     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 355559..365678
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKFA7_RS01815 (ACKFA7_01815) - 357171..357854 (+) 684 WP_007609386.1 response regulator transcription factor -
  ACKFA7_RS01820 (ACKFA7_01820) - 357841..359268 (+) 1428 WP_162472289.1 HAMP domain-containing sensor histidine kinase -
  ACKFA7_RS01825 (ACKFA7_01825) rapC 359427..360575 (+) 1149 WP_038456948.1 Rap family tetratricopeptide repeat protein Regulator
  ACKFA7_RS01830 (ACKFA7_01830) phrC 360559..360678 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACKFA7_RS01835 (ACKFA7_01835) - 360827..360937 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACKFA7_RS01840 (ACKFA7_01840) - 361017..362381 (-) 1365 WP_038456950.1 aspartate kinase -
  ACKFA7_RS01845 (ACKFA7_01845) ceuB 362795..363748 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  ACKFA7_RS01850 (ACKFA7_01850) - 363738..364685 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACKFA7_RS01855 (ACKFA7_01855) - 364679..365437 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=1078115 ACKFA7_RS01830 WP_033575081.1 360559..360678(+) (phrC) [Bacillus amyloliquefaciens strain 4-9-2]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1078115 ACKFA7_RS01830 WP_033575081.1 360559..360678(+) (phrC) [Bacillus amyloliquefaciens strain 4-9-2]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment