Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACJ1CH_RS01980 Genome accession   NZ_CP175541
Coordinates   420524..420643 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain Tcba05     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 415524..425643
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJ1CH_RS01965 (ACJ1CH_01965) - 417136..417819 (+) 684 WP_024084885.1 response regulator transcription factor -
  ACJ1CH_RS01970 (ACJ1CH_01970) - 417806..419239 (+) 1434 WP_161625271.1 sensor histidine kinase -
  ACJ1CH_RS01975 (ACJ1CH_01975) rapC 419392..420540 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  ACJ1CH_RS01980 (ACJ1CH_01980) phrC 420524..420643 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACJ1CH_RS01985 (ACJ1CH_01985) - 420793..420903 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACJ1CH_RS01990 (ACJ1CH_01990) - 420983..422347 (-) 1365 WP_003156333.1 aspartate kinase -
  ACJ1CH_RS01995 (ACJ1CH_01995) ceuB 422762..423715 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  ACJ1CH_RS02000 (ACJ1CH_02000) - 423705..424652 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  ACJ1CH_RS02005 (ACJ1CH_02005) - 424646..425404 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1078011 ACJ1CH_RS01980 WP_003156334.1 420524..420643(+) (phrC) [Bacillus velezensis strain Tcba05]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1078011 ACJ1CH_RS01980 WP_003156334.1 420524..420643(+) (phrC) [Bacillus velezensis strain Tcba05]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment