Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACJGE4_RS02140 Genome accession   NZ_CP174519
Coordinates   423715..423834 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain JD-3     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 418715..428834
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJGE4_RS02125 (ACJGE4_02125) - 420327..421010 (+) 684 WP_007410267.1 response regulator transcription factor -
  ACJGE4_RS02130 (ACJGE4_02130) - 420997..422430 (+) 1434 WP_162492834.1 HAMP domain-containing sensor histidine kinase -
  ACJGE4_RS02135 (ACJGE4_02135) rapC 422583..423731 (+) 1149 WP_012116798.1 Rap family tetratricopeptide repeat protein Regulator
  ACJGE4_RS02140 (ACJGE4_02140) phrC 423715..423834 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACJGE4_RS02145 (ACJGE4_02145) - 423982..424092 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACJGE4_RS02150 (ACJGE4_02150) - 424172..425536 (-) 1365 WP_094031502.1 aspartate kinase -
  ACJGE4_RS02155 (ACJGE4_02155) ceuB 425950..426903 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  ACJGE4_RS02160 (ACJGE4_02160) - 426893..427840 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  ACJGE4_RS02165 (ACJGE4_02165) - 427834..428592 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1077694 ACJGE4_RS02140 WP_003156334.1 423715..423834(+) (phrC) [Bacillus velezensis strain JD-3]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1077694 ACJGE4_RS02140 WP_003156334.1 423715..423834(+) (phrC) [Bacillus velezensis strain JD-3]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment