Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACJA24_RS14720 Genome accession   NZ_CP174198
Coordinates   2988449..2988589 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LQ-03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2983449..2993589
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJA24_RS14700 - 2983746..2984129 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ACJA24_RS14705 comA 2984151..2984795 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACJA24_RS14710 comP 2984876..2987179 (-) 2304 WP_003152050.1 histidine kinase Regulator
  ACJA24_RS14715 comQ 2987332..2988264 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACJA24_RS14720 degQ 2988449..2988589 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACJA24_RS14725 - 2989055..2989396 (+) 342 WP_014305721.1 hypothetical protein -
  ACJA24_RS14730 - 2989403..2990623 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACJA24_RS14735 - 2990753..2992219 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACJA24_RS14740 - 2992237..2992788 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACJA24_RS14745 - 2992885..2993283 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1074940 ACJA24_RS14720 WP_003152043.1 2988449..2988589(-) (degQ) [Bacillus velezensis strain LQ-03]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1074940 ACJA24_RS14720 WP_003152043.1 2988449..2988589(-) (degQ) [Bacillus velezensis strain LQ-03]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment