Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   ACJED3_RS20535 Genome accession   NZ_CP174155
Coordinates   3867218..3867628 (+) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain G01     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3844332..3883918 3867218..3867628 within 0


Gene organization within MGE regions


Location: 3844332..3883918
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJED3_RS20375 - 3844332..3844512 (+) 181 Protein_3953 hypothetical protein -
  ACJED3_RS20380 - 3844821..3845051 (+) 231 WP_224588644.1 hypothetical protein -
  ACJED3_RS20385 - 3845196..3845444 (+) 249 Protein_3955 hypothetical protein -
  ACJED3_RS20390 - 3845407..3845529 (+) 123 Protein_3956 RusA family crossover junction endodeoxyribonuclease -
  ACJED3_RS20395 - 3845612..3845764 (+) 153 WP_049832653.1 XtrA/YqaO family protein -
  ACJED3_RS20400 - 3845903..3846169 (-) 267 WP_033881358.1 hypothetical protein -
  ACJED3_RS20405 - 3846786..3847265 (+) 480 WP_014480344.1 hypothetical protein -
  ACJED3_RS20410 - 3847658..3847963 (-) 306 WP_123772463.1 hypothetical protein -
  ACJED3_RS20415 terS 3848090..3848654 (+) 565 Protein_3961 phage terminase small subunit -
  ACJED3_RS20420 - 3848614..3849089 (+) 476 Protein_3962 phage tail tube protein -
  ACJED3_RS20425 - 3849376..3849462 (-) 87 WP_072592549.1 putative holin-like toxin -
  ACJED3_RS20430 - 3849637..3849803 (+) 167 Protein_3964 peptidoglycan-binding protein -
  ACJED3_RS20435 istB 3850055..3850813 (-) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  ACJED3_RS20440 istA 3850810..3852357 (-) 1548 WP_014480339.1 IS21 family transposase -
  ACJED3_RS20445 - 3853198..3853488 (-) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  ACJED3_RS20450 atxG 3853598..3854175 (-) 578 Protein_3968 suppressor of fused domain protein -
  ACJED3_RS20455 - 3854443..3854676 (-) 234 WP_224588641.1 hypothetical protein -
  ACJED3_RS20460 - 3854765..3854968 (+) 204 WP_123772462.1 hypothetical protein -
  ACJED3_RS20465 - 3855276..3855755 (-) 480 WP_224588637.1 hypothetical protein -
  ACJED3_RS20470 cdiI 3855860..3856219 (-) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  ACJED3_RS20475 - 3856316..3856768 (-) 453 WP_014480333.1 SMI1/KNR4 family protein -
  ACJED3_RS20480 - 3856867..3857307 (-) 441 WP_014480332.1 SMI1/KNR4 family protein -
  ACJED3_RS20485 - 3857710..3857997 (-) 288 WP_014480331.1 hypothetical protein -
  ACJED3_RS20490 - 3858011..3858718 (-) 708 WP_014480330.1 hypothetical protein -
  ACJED3_RS20495 - 3859104..3859937 (-) 834 Protein_3977 ribonuclease YeeF family protein -
  ACJED3_RS20500 - 3860119..3861246 (+) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  ACJED3_RS20505 - 3861986..3862381 (-) 396 WP_014480327.1 VOC family protein -
  ACJED3_RS20510 - 3863323..3864213 (-) 891 WP_014480326.1 LysR family transcriptional regulator -
  ACJED3_RS20515 fumC 3864380..3865768 (+) 1389 WP_014480325.1 class II fumarate hydratase -
  ACJED3_RS20520 - 3865987..3866199 (+) 213 Protein_3982 recombinase family protein -
  ACJED3_RS20525 - 3866196..3866294 (-) 99 WP_031600702.1 hypothetical protein -
  ACJED3_RS20530 sigK 3866294..3867022 (-) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  ACJED3_RS20535 nucA/comI 3867218..3867628 (+) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  ACJED3_RS20540 yqeB 3867661..3868383 (-) 723 WP_014480321.1 hypothetical protein -
  ACJED3_RS20545 gnd 3868634..3869527 (+) 894 WP_014480320.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  ACJED3_RS20550 yqeD 3869546..3870172 (-) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  ACJED3_RS20555 cwlH 3870359..3871111 (+) 753 WP_014480318.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  ACJED3_RS20560 yqeF 3871363..3872094 (+) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  ACJED3_RS20565 - 3872400..3872540 (-) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  ACJED3_RS20570 yqeG 3872902..3873420 (+) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  ACJED3_RS20575 yqeH 3873424..3874524 (+) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  ACJED3_RS20580 aroE 3874542..3875384 (+) 843 WP_014480317.1 shikimate dehydrogenase -
  ACJED3_RS20585 yhbY 3875378..3875668 (+) 291 WP_003226133.1 ribosome assembly RNA-binding protein YhbY -
  ACJED3_RS20590 nadD 3875680..3876249 (+) 570 WP_004398676.1 nicotinate-nucleotide adenylyltransferase -
  ACJED3_RS20595 yqeK 3876239..3876799 (+) 561 WP_014480316.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK -
  ACJED3_RS20600 rsfS 3876817..3877173 (+) 357 WP_014480315.1 ribosome silencing factor -
  ACJED3_RS20605 yqeM 3877170..3877913 (+) 744 WP_014480314.1 class I SAM-dependent methyltransferase -
  ACJED3_RS20610 comER 3877979..3878800 (-) 822 WP_014480313.1 late competence protein ComER -
  ACJED3_RS20615 comEA 3878884..3879501 (+) 618 WP_014480312.1 competence protein ComEA Machinery gene
  ACJED3_RS20620 comEB 3879568..3880137 (+) 570 WP_003229978.1 ComE operon protein 2 -
  ACJED3_RS20625 comEC 3880141..3882471 (+) 2331 WP_033881047.1 DNA internalization-related competence protein ComEC/Rec2 Machinery gene
  ACJED3_RS20630 yqzM 3882511..3882645 (-) 135 WP_003229983.1 YqzM family protein -
  ACJED3_RS20635 - 3882686..3882835 (+) 150 WP_003229985.1 hypothetical protein -
  ACJED3_RS20640 holA 3882875..3883918 (+) 1044 WP_014480310.1 DNA polymerase III subunit delta -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=1074621 ACJED3_RS20535 WP_009967785.1 3867218..3867628(+) (nucA/comI) [Bacillus subtilis strain G01]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=1074621 ACJED3_RS20535 WP_009967785.1 3867218..3867628(+) (nucA/comI) [Bacillus subtilis strain G01]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment