Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ACI8NS_RS14235 Genome accession   NZ_CP174125
Coordinates   2889614..2889733 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain AX22     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 2884614..2894733
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACI8NS_RS14210 (ACI8NS_14210) - 2884853..2885611 (-) 759 WP_007609404.1 ABC transporter ATP-binding protein -
  ACI8NS_RS14215 (ACI8NS_14215) - 2885605..2886552 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACI8NS_RS14220 (ACI8NS_14220) ceuB 2886542..2887495 (-) 954 WP_032872883.1 ABC transporter permease Machinery gene
  ACI8NS_RS14225 (ACI8NS_14225) - 2887909..2889273 (+) 1365 WP_007609394.1 aspartate kinase -
  ACI8NS_RS14230 (ACI8NS_14230) - 2889353..2889463 (+) 111 WP_369878517.1 YjcZ family sporulation protein -
  ACI8NS_RS14235 (ACI8NS_14235) phrC 2889614..2889733 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACI8NS_RS14240 (ACI8NS_14240) rapC 2889717..2890865 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  ACI8NS_RS14245 (ACI8NS_14245) - 2891018..2892451 (-) 1434 WP_161503657.1 HAMP domain-containing sensor histidine kinase -
  ACI8NS_RS14250 (ACI8NS_14250) - 2892438..2893121 (-) 684 WP_032872879.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1074484 ACI8NS_RS14235 WP_003156334.1 2889614..2889733(-) (phrC) [Bacillus velezensis strain AX22]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1074484 ACI8NS_RS14235 WP_003156334.1 2889614..2889733(-) (phrC) [Bacillus velezensis strain AX22]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment