Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACCO37_RS14770 Genome accession   NZ_CP174101
Coordinates   2998373..2998513 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BHZ-29     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2993373..3003513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCO37_RS14745 - 2993719..2994102 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  ACCO37_RS14750 comA 2994124..2994768 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACCO37_RS14755 comP 2994849..2997149 (-) 2301 WP_032876801.1 histidine kinase Regulator
  ACCO37_RS14760 comX 2997163..2997336 (-) 174 WP_012118314.1 competence pheromone ComX -
  ACCO37_RS14765 - 2997305..2998165 (-) 861 WP_142925231.1 polyprenyl synthetase family protein -
  ACCO37_RS14770 degQ 2998373..2998513 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACCO37_RS14775 - 2998979..2999320 (+) 342 WP_032876795.1 hypothetical protein -
  ACCO37_RS14780 - 2999327..3000550 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  ACCO37_RS14785 - 3000680..3002146 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ACCO37_RS14790 - 3002164..3002715 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACCO37_RS14795 - 3002812..3003210 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1074315 ACCO37_RS14770 WP_003152043.1 2998373..2998513(-) (degQ) [Bacillus velezensis strain BHZ-29]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1074315 ACCO37_RS14770 WP_003152043.1 2998373..2998513(-) (degQ) [Bacillus velezensis strain BHZ-29]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment