Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACCO37_RS11670 Genome accession   NZ_CP174101
Coordinates   2435709..2435882 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain BHZ-29     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2430709..2440882
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCO37_RS11655 gcvT 2431523..2432623 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  ACCO37_RS11660 - 2433046..2434716 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  ACCO37_RS11665 - 2434738..2435532 (+) 795 WP_007612541.1 YqhG family protein -
  ACCO37_RS11670 sinI 2435709..2435882 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  ACCO37_RS11675 sinR 2435916..2436251 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACCO37_RS11680 tasA 2436299..2437084 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  ACCO37_RS11685 sipW 2437149..2437733 (-) 585 WP_032874025.1 signal peptidase I SipW -
  ACCO37_RS11690 tapA 2437705..2438376 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  ACCO37_RS11695 - 2438635..2438964 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  ACCO37_RS11700 - 2439005..2439184 (-) 180 WP_022552966.1 YqzE family protein -
  ACCO37_RS11705 comGG 2439241..2439618 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACCO37_RS11710 comGF 2439619..2440119 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  ACCO37_RS11715 comGE 2440028..2440342 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACCO37_RS11720 comGD 2440326..2440763 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=1074293 ACCO37_RS11670 WP_032874029.1 2435709..2435882(+) (sinI) [Bacillus velezensis strain BHZ-29]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1074293 ACCO37_RS11670 WP_032874029.1 2435709..2435882(+) (sinI) [Bacillus velezensis strain BHZ-29]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment