Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AAA995_RS02655 Genome accession   NZ_AP028877
Coordinates   511774..511923 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 21P20     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 510103..510907 511774..511923 flank 867


Gene organization within MGE regions


Location: 510103..511923
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAA995_RS02640 - 510103..510907 (+) 805 Protein_519 IS5 family transposase -
  AAA995_RS02645 (SP21P20_05200) blpM 511057..511311 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AAA995_RS02650 (SP21P20_05210) blpN 511327..511530 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AAA995_RS02655 (SP21P20_05220) cipB 511774..511923 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=107180 AAA995_RS02655 WP_001809846.1 511774..511923(+) (cipB) [Streptococcus pneumoniae strain 21P20]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=107180 AAA995_RS02655 WP_001809846.1 511774..511923(+) (cipB) [Streptococcus pneumoniae strain 21P20]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531


Multiple sequence alignment