Detailed information    

insolico Bioinformatically predicted

Overview


Name   HI0659   Type   Machinery gene
Locus tag   ACIZ62_RS04310 Genome accession   NZ_CP173357
Coordinates   904375..904737 (+) Length   120 a.a.
NCBI ID   WP_414151295.1    Uniprot ID   -
Organism   Acetobacterium carbinolicum strain DSM 2925     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 863092..903484 904375..904737 flank 891


Gene organization within MGE regions


Location: 863092..904737
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACIZ62_RS04085 (ACIZ62_04085) - 864627..864977 (+) 351 WP_322519518.1 hypothetical protein -
  ACIZ62_RS04090 (ACIZ62_04090) - 864974..865390 (+) 417 WP_322519517.1 ATP-binding protein -
  ACIZ62_RS04095 (ACIZ62_04095) - 865409..866752 (+) 1344 WP_322519516.1 [Fe-Fe] hydrogenase large subunit C-terminal domain-containing protein -
  ACIZ62_RS04100 (ACIZ62_04100) - 866862..867194 (+) 333 WP_111887830.1 AraC family transcriptional regulator -
  ACIZ62_RS04105 (ACIZ62_04105) - 867195..867923 (+) 729 WP_414151270.1 PHP domain-containing protein -
  ACIZ62_RS04110 (ACIZ62_04110) - 868318..868788 (+) 471 WP_111887828.1 complex I 24 kDa subunit family protein -
  ACIZ62_RS04115 (ACIZ62_04115) - 868798..869355 (+) 558 WP_414151271.1 ATP-binding protein -
  ACIZ62_RS04120 (ACIZ62_04120) - 869355..869753 (+) 399 WP_111887826.1 (2Fe-2S) ferredoxin domain-containing protein -
  ACIZ62_RS04125 (ACIZ62_04125) nuoF 869773..871572 (+) 1800 WP_414151272.1 NADH-quinone oxidoreductase subunit NuoF -
  ACIZ62_RS04130 (ACIZ62_04130) - 871592..873343 (+) 1752 WP_111887824.1 NADH-dependent [FeFe] hydrogenase, group A6 -
  ACIZ62_RS04135 (ACIZ62_04135) - 873442..875655 (+) 2214 WP_414151273.1 ATP-dependent RecD-like DNA helicase -
  ACIZ62_RS04140 (ACIZ62_04140) - 875728..876477 (+) 750 WP_414151274.1 ComF family protein -
  ACIZ62_RS04145 (ACIZ62_04145) murB 876587..877495 (+) 909 WP_111887821.1 UDP-N-acetylmuramate dehydrogenase -
  ACIZ62_RS04150 (ACIZ62_04150) - 877500..878231 (+) 732 WP_111887820.1 PHP domain-containing protein -
  ACIZ62_RS04155 (ACIZ62_04155) rapZ 878241..879113 (+) 873 WP_414151275.1 RNase adapter RapZ -
  ACIZ62_RS04160 (ACIZ62_04160) - 879245..880255 (+) 1011 WP_414151276.1 gluconeogenesis factor YvcK family protein -
  ACIZ62_RS04165 (ACIZ62_04165) whiA 880344..881354 (+) 1011 WP_414151277.1 DNA-binding protein WhiA -
  ACIZ62_RS04170 (ACIZ62_04170) - 881525..882103 (-) 579 WP_414151278.1 sigma-70 family RNA polymerase sigma factor -
  ACIZ62_RS04175 (ACIZ62_04175) - 882358..882582 (-) 225 WP_322519508.1 DUF2922 domain-containing protein -
  ACIZ62_RS04180 (ACIZ62_04180) - 882620..882844 (-) 225 WP_414151279.1 DUF1659 domain-containing protein -
  ACIZ62_RS04185 (ACIZ62_04185) - 882997..883392 (-) 396 WP_414151280.1 holin family protein -
  ACIZ62_RS04190 (ACIZ62_04190) - 883515..884570 (-) 1056 WP_414151281.1 PocR ligand-binding domain-containing protein -
  ACIZ62_RS04195 (ACIZ62_04195) - 885131..885724 (+) 594 WP_414151282.1 RNA polymerase sigma factor -
  ACIZ62_RS04200 (ACIZ62_04200) - 885724..886839 (+) 1116 WP_414151283.1 hypothetical protein -
  ACIZ62_RS04205 (ACIZ62_04205) - 887718..890852 (+) 3135 WP_414151284.1 hypothetical protein -
  ACIZ62_RS04210 (ACIZ62_04210) - 891031..891162 (-) 132 Protein_803 ATP-binding protein -
  ACIZ62_RS04215 (ACIZ62_04215) istA 891327..892448 (+) 1122 WP_414151285.1 IS21 family transposase -
  ACIZ62_RS04220 (ACIZ62_04220) - 893039..893392 (+) 354 WP_414151286.1 type II toxin-antitoxin system RelE/ParE family toxin -
  ACIZ62_RS04225 (ACIZ62_04225) HI0659 893395..893757 (+) 363 WP_414151287.1 helix-turn-helix domain-containing protein Machinery gene
  ACIZ62_RS04230 (ACIZ62_04230) - 894164..894397 (+) 234 WP_111887801.1 hypothetical protein -
  ACIZ62_RS04235 (ACIZ62_04235) - 894438..894545 (+) 108 WP_414151288.1 Rpn family recombination-promoting nuclease/putative transposase -
  ACIZ62_RS04240 (ACIZ62_04240) - 894558..895460 (+) 903 WP_414151836.1 Rpn family recombination-promoting nuclease/putative transposase -
  ACIZ62_RS04245 (ACIZ62_04245) - 895461..895790 (+) 330 WP_414151289.1 transposase -
  ACIZ62_RS04250 (ACIZ62_04250) - 895884..896282 (+) 399 WP_414151290.1 hypothetical protein -
  ACIZ62_RS04255 (ACIZ62_04255) - 896581..897630 (+) 1050 WP_414151291.1 Rpn family recombination-promoting nuclease/putative transposase -
  ACIZ62_RS04260 (ACIZ62_04260) - 898354..898671 (+) 318 WP_414151292.1 Rpn family recombination-promoting nuclease/putative transposase -
  ACIZ62_RS04265 (ACIZ62_04265) - 898749..899549 (-) 801 WP_414151293.1 ExeA family protein -
  ACIZ62_RS04270 (ACIZ62_04270) - 899542..900801 (-) 1260 WP_414150292.1 DDE-type integrase/transposase/recombinase -
  ACIZ62_RS04275 (ACIZ62_04275) - 900948..901484 (-) 537 WP_414150291.1 transposase -
  ACIZ62_RS04280 (ACIZ62_04280) - 901594..902391 (+) 798 WP_414151294.1 Rpn family recombination-promoting nuclease/putative transposase -
  ACIZ62_RS04285 (ACIZ62_04285) - 902635..902805 (+) 171 WP_371414198.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  ACIZ62_RS04290 (ACIZ62_04290) - 902723..902911 (+) 189 WP_371414224.1 hypothetical protein -
  ACIZ62_RS04295 (ACIZ62_04295) - 902908..903192 (+) 285 WP_242988636.1 PIN domain-containing protein -
  ACIZ62_RS04300 (ACIZ62_04300) - 903638..903883 (-) 246 WP_256372209.1 transposase -
  ACIZ62_RS04305 (ACIZ62_04305) - 904065..904382 (+) 318 WP_204355490.1 type II toxin-antitoxin system RelE/ParE family toxin -
  ACIZ62_RS04310 (ACIZ62_04310) HI0659 904375..904737 (+) 363 WP_414151295.1 helix-turn-helix domain-containing protein Machinery gene

Sequence


Protein


Download         Length: 120 a.a.        Molecular weight: 13718.06 Da        Isoelectric Point: 10.7136

>NTDB_id=1071576 ACIZ62_RS04310 WP_414151295.1 904375..904737(+) (HI0659) [Acetobacterium carbinolicum strain DSM 2925]
MSKTKVSPIGSSWDEFEKKTFTPEEIMESDLRVALISELIRARNDQGITQKQLEEASGVKQPVIARMEKGTTDPQLMTIL
KILRPLGKTLAIVPIEEKQPRNIHLRTFKKGSTFRQKPMR

Nucleotide


Download         Length: 363 bp        

>NTDB_id=1071576 ACIZ62_RS04310 WP_414151295.1 904375..904737(+) (HI0659) [Acetobacterium carbinolicum strain DSM 2925]
ATGAGTAAGACAAAAGTAAGTCCCATTGGATCAAGCTGGGATGAGTTTGAGAAAAAAACATTCACCCCGGAAGAAATAAT
GGAATCTGATTTGAGAGTAGCATTAATAAGCGAACTAATCCGTGCTAGAAATGATCAGGGAATCACCCAAAAGCAGTTGG
AAGAAGCAAGTGGTGTTAAGCAACCCGTCATTGCCCGAATGGAAAAAGGTACAACTGATCCCCAATTGATGACTATTTTA
AAAATACTAAGACCACTTGGCAAGACCTTGGCCATTGTGCCAATTGAAGAAAAACAACCCCGAAACATTCATTTGAGAAC
ATTTAAAAAAGGCAGCACATTCAGGCAAAAGCCCATGAGATAA

Domains


Predicted by InterproScan.

(41-91)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

65.263

79.167

0.517


Multiple sequence alignment