Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   ACF1RT_RS05855 Genome accession   NZ_CP172847
Coordinates   1154864..1155298 (-) Length   144 a.a.
NCBI ID   WP_002263292.1    Uniprot ID   A0AAX1K4B8
Organism   Streptococcus mutans strain DPC6143     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1151314..1189532 1154864..1155298 within 0


Gene organization within MGE regions


Location: 1151314..1189532
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF1RT_RS05845 (ACF1RT_05845) rcrQ 1151314..1153068 (-) 1755 WP_226716855.1 ABC transporter transmembrane domain-containing protein Regulator
  ACF1RT_RS05850 (ACF1RT_05850) rcrP 1153058..1154860 (-) 1803 WP_002266459.1 ABC transporter ATP-binding protein Regulator
  ACF1RT_RS05855 (ACF1RT_05855) rcrR 1154864..1155298 (-) 435 WP_002263292.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  ACF1RT_RS05860 (ACF1RT_05860) queC 1155851..1156504 (+) 654 WP_002269531.1 7-cyano-7-deazaguanine synthase QueC -
  ACF1RT_RS05865 (ACF1RT_05865) queD 1156504..1156950 (+) 447 WP_002266457.1 6-carboxytetrahydropterin synthase QueD -
  ACF1RT_RS05870 (ACF1RT_05870) queE 1156947..1157663 (+) 717 WP_002263289.1 7-carboxy-7-deazaguanine synthase QueE -
  ACF1RT_RS05875 (ACF1RT_05875) queF 1157676..1158164 (+) 489 WP_002263288.1 preQ(1) synthase -
  ACF1RT_RS05880 (ACF1RT_05880) - 1158273..1158668 (+) 396 WP_400260296.1 DUF3021 family protein -
  ACF1RT_RS05885 (ACF1RT_05885) gdhA 1158780..1160129 (-) 1350 WP_002263849.1 NADP-specific glutamate dehydrogenase -
  ACF1RT_RS05890 (ACF1RT_05890) - 1160880..1161386 (+) 507 WP_002281566.1 DUF308 domain-containing protein -
  ACF1RT_RS05895 (ACF1RT_05895) gtfD 1161609..1165997 (-) 4389 WP_400260297.1 glucosyltransferase-S -
  ACF1RT_RS05900 (ACF1RT_05900) - 1166218..1167138 (-) 921 WP_002269023.1 AEC family transporter -
  ACF1RT_RS05905 (ACF1RT_05905) - 1167254..1169026 (-) 1773 WP_019313201.1 ABC transporter ATP-binding protein -
  ACF1RT_RS05910 (ACF1RT_05910) - 1169037..1170773 (-) 1737 WP_226711192.1 ABC transporter transmembrane domain-containing protein -
  ACF1RT_RS05915 (ACF1RT_05915) - 1171229..1173097 (-) 1869 WP_226711193.1 ABC-F family ATP-binding cassette domain-containing protein -
  ACF1RT_RS05920 (ACF1RT_05920) - 1173100..1174305 (-) 1206 WP_002294333.1 CCA tRNA nucleotidyltransferase -
  ACF1RT_RS05925 (ACF1RT_05925) dapB 1174302..1175069 (-) 768 WP_226711194.1 4-hydroxy-tetrahydrodipicolinate reductase -
  ACF1RT_RS05930 (ACF1RT_05930) - 1175081..1175926 (-) 846 WP_226711195.1 DegV family protein -
  ACF1RT_RS05935 (ACF1RT_05935) - 1175932..1176306 (-) 375 WP_002262891.1 DUF1149 family protein -
  ACF1RT_RS05940 (ACF1RT_05940) - 1176415..1177956 (-) 1542 WP_226711196.1 hypothetical protein -
  ACF1RT_RS05945 (ACF1RT_05945) - 1177943..1178659 (-) 717 WP_226711197.1 ABC transporter ATP-binding protein -
  ACF1RT_RS05950 (ACF1RT_05950) - 1178734..1179339 (-) 606 WP_400260298.1 TetR/AcrR family transcriptional regulator -
  ACF1RT_RS05955 (ACF1RT_05955) - 1179503..1180003 (-) 501 WP_315685139.1 phosphatase PAP2 family protein -
  ACF1RT_RS05960 (ACF1RT_05960) - 1180246..1181325 (-) 1080 WP_002271491.1 serine hydrolase -
  ACF1RT_RS05965 (ACF1RT_05965) galE 1181593..1182594 (-) 1002 WP_002265099.1 UDP-glucose 4-epimerase GalE -
  ACF1RT_RS05970 (ACF1RT_05970) galT 1182743..1184218 (-) 1476 WP_002265098.1 UDP-glucose--hexose-1-phosphate uridylyltransferase -
  ACF1RT_RS05975 (ACF1RT_05975) - 1184223..1185395 (-) 1173 WP_002262879.1 galactokinase -
  ACF1RT_RS05980 (ACF1RT_05980) - 1185538..1186536 (+) 999 WP_226711200.1 substrate-binding domain-containing protein -
  ACF1RT_RS05985 (ACF1RT_05985) dexB 1186698..1188308 (-) 1611 WP_226711202.1 glucan 1,6-alpha-glucosidase DexB -
  ACF1RT_RS05990 (ACF1RT_05990) - 1188399..1189532 (-) 1134 WP_002262876.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 16720.58 Da        Isoelectric Point: 10.5126

>NTDB_id=1069095 ACF1RT_RS05855 WP_002263292.1 1154864..1155298(-) (rcrR) [Streptococcus mutans strain DPC6143]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide


Download         Length: 435 bp        

>NTDB_id=1069095 ACF1RT_RS05855 WP_002263292.1 1154864..1155298(-) (rcrR) [Streptococcus mutans strain DPC6143]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGAAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(31-89)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

100

100

1

Multiple sequence alignment