Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACHGMI_RS18740 Genome accession   NZ_CP172417
Coordinates   3412988..3413128 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain AKPS2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3407988..3418128
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHGMI_RS18715 mcpB 3408602..3410590 (+) 1989 WP_017695503.1 methyl-accepting chemotaxis protein McpB -
  ACHGMI_RS18720 tlpA 3410744..3411349 (+) 606 Protein_3625 methyl-accepting chemotaxis protein TlpA -
  ACHGMI_RS18725 - 3411333..3411701 (-) 369 WP_413158321.1 hypothetical protein -
  ACHGMI_RS18730 comX 3411717..3411938 (-) 222 WP_014480704.1 competence pheromone ComX -
  ACHGMI_RS18735 - 3411940..3412803 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  ACHGMI_RS18740 degQ 3412988..3413128 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACHGMI_RS18745 - 3413350..3413412 (+) 63 Protein_3630 hypothetical protein -
  ACHGMI_RS18750 - 3413590..3413958 (+) 369 WP_017695529.1 hypothetical protein -
  ACHGMI_RS18755 pdeH 3413934..3415163 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACHGMI_RS18760 - 3415300..3416772 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACHGMI_RS18765 - 3416788..3417339 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  ACHGMI_RS18770 yueI 3417436..3417834 (-) 399 WP_017695530.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1067614 ACHGMI_RS18740 WP_003220708.1 3412988..3413128(-) (degQ) [Bacillus subtilis strain AKPS2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1067614 ACHGMI_RS18740 WP_003220708.1 3412988..3413128(-) (degQ) [Bacillus subtilis strain AKPS2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment