Detailed information    

insolico Bioinformatically predicted

Overview

Name   comS   Type   Regulator
Locus tag   ACHGMI_RS02475 Genome accession   NZ_CP172417
Coordinates   478941..479081 (-) Length   46 a.a.
NCBI ID   WP_225910706.1    Uniprot ID   -
Organism   Bacillus subtilis strain AKPS2     
Function   preventing the degradation of ComK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 470633..486169 478941..479081 within 0


Gene organization within MGE regions


Location: 470633..486169
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHGMI_RS02440 - 470645..471037 (-) 393 Protein_438 AMP-binding protein -
  ACHGMI_RS02445 - 471037..471969 (+) 933 Protein_439 AMP-binding protein -
  ACHGMI_RS02450 - 471969..472901 (-) 933 Protein_440 AMP-binding protein -
  ACHGMI_RS02455 - 472905..474230 (+) 1326 Protein_441 AMP-binding protein -
  ACHGMI_RS02460 - 474255..474455 (+) 201 WP_413158709.1 AMP-binding protein -
  ACHGMI_RS02465 - 474409..477750 (-) 3342 WP_413158710.1 amino acid adenylation domain-containing protein -
  ACHGMI_RS02470 - 477823..478995 (-) 1173 Protein_444 condensation domain-containing protein -
  ACHGMI_RS02475 comS 478941..479081 (-) 141 WP_225910706.1 competence protein ComS Regulator
  ACHGMI_RS02480 srfAB 479173..482214 (-) 3042 Protein_446 surfactin non-ribosomal peptide synthetase SrfAB -
  ACHGMI_RS02485 - 482227..483931 (-) 1705 Protein_447 condensation domain-containing protein -
  ACHGMI_RS02490 - 483931..484863 (+) 933 Protein_448 AMP-binding protein -
  ACHGMI_RS02495 - 484863..485807 (-) 945 Protein_449 AMP-binding protein -
  ACHGMI_RS02500 - 485798..486136 (+) 339 Protein_450 phosphopantetheine-binding protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5260.11 Da        Isoelectric Point: 8.7633

>NTDB_id=1067553 ACHGMI_RS02475 WP_225910706.1 478941..479081(-) (comS) [Bacillus subtilis strain AKPS2]
MNRSGKHLISCIILYPRPSGECISSISLDKQTQATTSPLYFCWREK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1067553 ACHGMI_RS02475 WP_225910706.1 478941..479081(-) (comS) [Bacillus subtilis strain AKPS2]
TTGAACCGATCAGGCAAGCATCTTATCAGCTGCATTATCCTGTATCCCCGGCCCAGCGGAGAATGTATATCCTCAATCAG
CTTGGACAAGCAAACACAAGCTACAACGTCCCCGCTGTACTTCTGCTGGAGGGAGAAGTAG

Domains

Predicted by InterproScan.

Bacillus competence protein S (ComS)

(1-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comS Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978

Multiple sequence alignment