Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AABJ45_RS02615 Genome accession   NZ_AP028611
Coordinates   521722..521871 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain Sep6     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 520132..520855 521722..521871 flank 867


Gene organization within MGE regions


Location: 520132..521871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ45_RS02605 (TKY121527_05200) blpM 521005..521259 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AABJ45_RS02610 (TKY121527_05210) blpN 521275..521478 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AABJ45_RS02615 (TKY121527_05220) cipB 521722..521871 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=106574 AABJ45_RS02615 WP_001818346.1 521722..521871(+) (cipB) [Streptococcus pneumoniae strain Sep6]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=106574 AABJ45_RS02615 WP_001818346.1 521722..521871(+) (cipB) [Streptococcus pneumoniae strain Sep6]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment