Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   EG65_RS00205 Genome accession   NZ_CP007603
Coordinates   37765..37878 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori J166     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32765..42878
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EG65_RS00180 (EG65_00195) - 32818..35043 (+) 2226 WP_026938507.1 AAA family ATPase -
  EG65_RS00185 (EG65_00200) panD 35033..35386 (+) 354 WP_000142236.1 aspartate 1-decarboxylase -
  EG65_RS00190 (EG65_00205) - 35389..35691 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  EG65_RS00195 (EG65_00210) - 35691..36686 (+) 996 WP_026938506.1 PDZ domain-containing protein -
  EG65_RS00200 (EG65_00215) comB6 36694..37749 (+) 1056 WP_026938505.1 P-type conjugative transfer protein TrbL Machinery gene
  EG65_RS00205 comB7 37765..37878 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  EG65_RS00210 (EG65_00225) comB8 37875..38618 (+) 744 WP_026938504.1 type IV secretion system protein Machinery gene
  EG65_RS00215 (EG65_00230) comB9 38618..39601 (+) 984 WP_026938503.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  EG65_RS00220 (EG65_00235) comB10 39594..40724 (+) 1131 WP_026938502.1 DNA type IV secretion system protein ComB10 Machinery gene
  EG65_RS00225 (EG65_00240) - 40794..42206 (+) 1413 WP_026938501.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=106367 EG65_RS00205 WP_001217873.1 37765..37878(+) (comB7) [Helicobacter pylori J166]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=106367 EG65_RS00205 WP_001217873.1 37765..37878(+) (comB7) [Helicobacter pylori J166]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment