Detailed information    

insolico Bioinformatically predicted

Overview


Name   treR   Type   Regulator
Locus tag   AABA14_RS09165 Genome accession   NZ_AP028607
Coordinates   1780007..1780717 (+) Length   236 a.a.
NCBI ID   WP_000760673.1    Uniprot ID   A0A062WVH4
Organism   Streptococcus pneumoniae strain Sep2     
Function   regulate expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1729041..1784825 1780007..1780717 within 0


Gene organization within MGE regions


Location: 1729041..1784825
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABA14_RS08900 (TKY123642_17720) - 1729041..1730051 (-) 1011 WP_000589142.1 ABC transporter ATP-binding protein -
  AABA14_RS08905 (TKY123642_17730) - 1730155..1731222 (-) 1068 WP_338168403.1 extracellular solute-binding protein -
  AABA14_RS08910 (TKY123642_17740) - 1731247..1731906 (-) 660 WP_000793815.1 DUF1868 domain-containing protein -
  AABA14_RS08915 - 1732115..1732393 (-) 279 Protein_1764 GDP-mannose 4,6-dehydratase -
  AABA14_RS08920 - 1732635..1732932 (-) 298 Protein_1765 hypothetical protein -
  AABA14_RS08925 (TKY123642_17770) pfbA 1732916..1735075 (-) 2160 WP_078136303.1 multi-ligand-binding adhesin PfbA -
  AABA14_RS08930 (TKY123642_17790) - 1736206..1737432 (-) 1227 WP_016398358.1 DegT/DnrJ/EryC1/StrS aminotransferase family protein -
  AABA14_RS08935 (TKY123642_17800) - 1737475..1738167 (-) 693 WP_000922191.1 sugar transferase -
  AABA14_RS08940 (TKY123642_17810) - 1738340..1740091 (-) 1752 WP_001180131.1 ABC transporter ATP-binding protein -
  AABA14_RS08945 (TKY123642_17820) - 1740081..1741826 (-) 1746 WP_000022612.1 ABC transporter ATP-binding protein -
  AABA14_RS08950 (TKY123642_17830) - 1742032..1742328 (-) 297 WP_001820784.1 YetF domain-containing protein -
  AABA14_RS08955 - 1742481..1742936 (-) 456 Protein_1772 DUF3290 family protein -
  AABA14_RS08960 (TKY123642_17860) - 1743070..1743897 (+) 828 WP_000767464.1 exodeoxyribonuclease III -
  AABA14_RS08965 (TKY123642_17870) - 1743909..1744052 (+) 144 WP_001810834.1 VOC family protein -
  AABA14_RS08970 - 1744163..1744291 (+) 129 WP_001820785.1 hypothetical protein -
  AABA14_RS08975 (TKY123642_17880) - 1745170..1745751 (+) 582 WP_000770407.1 xanthine phosphoribosyltransferase -
  AABA14_RS08980 (TKY123642_17890) - 1745751..1747013 (+) 1263 WP_001194489.1 nucleobase:cation symporter-2 family protein -
  AABA14_RS08985 (TKY123642_17900) - 1747100..1747966 (-) 867 WP_000815111.1 type II restriction endonuclease -
  AABA14_RS08990 (TKY123642_17910) - 1747953..1748723 (-) 771 WP_001810592.1 site-specific DNA-methyltransferase -
  AABA14_RS08995 (TKY123642_17920) - 1748749..1749603 (-) 855 WP_000692847.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -
  AABA14_RS09000 (TKY123642_17930) - 1749760..1750164 (-) 405 WP_000651213.1 PaaI family thioesterase -
  AABA14_RS09005 (TKY123642_17940) - 1750234..1751715 (-) 1482 WP_044814708.1 UDP-glucose--hexose-1-phosphate uridylyltransferase -
  AABA14_RS09010 (TKY123642_17950) - 1751734..1752912 (-) 1179 WP_338168404.1 galactokinase -
  AABA14_RS09015 (TKY123642_17960) galR 1753076..1754083 (+) 1008 WP_000212512.1 DNA-binding transcriptional regulator GalR -
  AABA14_RS09020 (TKY123642_17970) - 1754129..1755155 (-) 1027 Protein_1785 zinc-binding dehydrogenase -
  AABA14_RS09025 (TKY123642_17980) nmlR 1755156..1755509 (-) 354 WP_001022629.1 stress response transcriptional regulator NmlR -
  AABA14_RS09030 (TKY123642_17990) czcD 1755753..1756643 (-) 891 WP_000645100.1 cation diffusion facilitator family transporter CzcD -
  AABA14_RS09035 (TKY123642_18000) sczA 1756776..1757312 (+) 537 WP_000181696.1 TetR/AcrR family transcriptional regulator SczA -
  AABA14_RS09040 (TKY123642_18010) pnuC 1757479..1758285 (-) 807 WP_001863945.1 nicotinamide riboside transporter PnuC -
  AABA14_RS09045 (TKY123642_18020) - 1758630..1760150 (-) 1521 WP_016399266.1 ABC transporter permease/substrate-binding protein -
  AABA14_RS09050 (TKY123642_18030) - 1760143..1760871 (-) 729 WP_000575210.1 ABC transporter ATP-binding protein -
  AABA14_RS09055 (TKY123642_18040) - 1760886..1761650 (-) 765 WP_000082875.1 nuclear transport factor 2 family protein -
  AABA14_RS09060 (TKY123642_18050) - 1761654..1762097 (-) 444 WP_000655202.1 MarR family transcriptional regulator -
  AABA14_RS09065 (TKY123642_18060) - 1762779..1763075 (-) 297 WP_000840137.1 bacteriocin immunity protein -
  AABA14_RS09070 (TKY123642_18070) pepA 1763097..1764161 (-) 1065 WP_000209191.1 glutamyl aminopeptidase -
  AABA14_RS09075 (TKY123642_18080) galE 1764562..1765263 (+) 702 WP_000167849.1 UDP-glucose 4-epimerase GalE -
  AABA14_RS09080 - 1765279..1765389 (+) 111 WP_001108391.1 hypothetical protein -
  AABA14_RS09085 (TKY123642_18090) - 1765686..1766645 (+) 960 WP_000777248.1 ABC transporter permease -
  AABA14_RS09090 (TKY123642_18100) - 1766635..1767591 (+) 957 WP_001193669.1 iron chelate uptake ABC transporter family permease subunit -
  AABA14_RS09095 (TKY123642_18110) - 1767588..1768340 (+) 753 WP_050084704.1 ATP-binding cassette domain-containing protein -
  AABA14_RS09100 (TKY123642_18120) - 1768436..1769401 (+) 966 WP_000858268.1 siderophore ABC transporter substrate-binding protein -
  AABA14_RS09105 (TKY123642_18130) yidD 1769626..1769868 (-) 243 WP_000821639.1 membrane protein insertion efficiency factor YidD -
  AABA14_RS09110 (TKY123642_18140) - 1769868..1770590 (-) 723 WP_001222228.1 pseudouridine synthase -
  AABA14_RS09115 (TKY123642_18150) scpB 1770577..1771146 (-) 570 WP_000105310.1 SMC-Scp complex subunit ScpB -
  AABA14_RS09120 (TKY123642_18160) - 1771165..1771893 (-) 729 WP_000351907.1 segregation/condensation protein A -
  AABA14_RS09125 (TKY123642_18170) xerD 1771893..1772627 (-) 735 WP_277730092.1 site-specific tyrosine recombinase XerD -
  AABA14_RS09130 (TKY123642_18180) cbpB 1772624..1773085 (-) 462 WP_000560726.1 cyclic-di-AMP-binding protein CbpB -
  AABA14_RS09135 (TKY123642_18190) - 1773082..1773603 (-) 522 WP_001118962.1 metallophosphoesterase -
  AABA14_RS09140 (TKY123642_18200) - 1773579..1774550 (-) 972 WP_000182412.1 nucleoside-triphosphate diphosphatase -
  AABA14_RS09145 (TKY123642_18210) racE 1774547..1775341 (-) 795 WP_000370376.1 glutamate racemase -
  AABA14_RS09150 (TKY123642_18220) - 1775548..1775796 (-) 249 WP_000364990.1 YneF family protein -
  AABA14_RS09155 (TKY123642_18230) treC 1776052..1777677 (-) 1626 WP_000171211.1 alpha,alpha-phosphotrehalase -
  AABA14_RS09160 (TKY123642_18240) treP 1777855..1779822 (-) 1968 WP_000514329.1 PTS system trehalose-specific EIIBC component -
  AABA14_RS09165 (TKY123642_18250) treR 1780007..1780717 (+) 711 WP_000760673.1 trehalose operon repressor Regulator
  AABA14_RS09170 (TKY123642_18260) - 1780750..1781553 (-) 804 WP_000157664.1 ATP-binding cassette domain-containing protein -
  AABA14_RS09175 (TKY123642_18270) - 1781566..1782459 (-) 894 WP_001012091.1 ABC transporter permease -
  AABA14_RS09180 - 1782471..1783408 (-) 938 Protein_1817 ABC transporter substrate-binding protein -
  AABA14_RS09185 (TKY123642_18300) amiF 1783899..1784825 (-) 927 WP_001291293.1 ATP-binding cassette domain-containing protein Regulator

Sequence


Protein


Download         Length: 236 a.a.        Molecular weight: 27607.78 Da        Isoelectric Point: 8.9698

>NTDB_id=106292 AABA14_RS09165 WP_000760673.1 1780007..1780717(+) (treR) [Streptococcus pneumoniae strain Sep2]
MKKYQQLFKQIQETIQNETYAVGDFLPSEHDLMEQYQVSRDTVRKALSLLQEEGLIKKIRGQGSQVVKEETVNFPVSNLT
SYQELVKELGLRSKTNVVSLDKIIIDKKSSLITGFPEFRMVWKVVRQRVVDDLVSVLDTDYLDMELIPNLTRQIAEQSIY
SYIENGLKLLIDYAQKEITIDHSSDRDKILMDIGKDPYVVSIKSKVYLQDGRQFQFTESRHKLEKFRFVDFAKRKK

Nucleotide


Download         Length: 711 bp        

>NTDB_id=106292 AABA14_RS09165 WP_000760673.1 1780007..1780717(+) (treR) [Streptococcus pneumoniae strain Sep2]
ATGAAGAAATACCAACAATTATTTAAGCAAATCCAAGAAACCATTCAAAACGAGACTTACGCTGTCGGAGATTTCCTTCC
TAGCGAGCACGACCTTATGGAGCAATATCAAGTGAGTCGTGATACCGTCCGAAAGGCCCTGTCTCTCCTCCAAGAGGAAG
GATTGATCAAAAAGATAAGAGGGCAAGGTTCTCAAGTCGTCAAAGAAGAAACCGTCAATTTCCCTGTATCCAACCTAACC
AGCTACCAAGAACTAGTTAAAGAACTTGGACTGCGCTCTAAAACCAACGTGGTCAGTCTGGACAAGATTATTATTGATAA
AAAATCCTCACTGATAACCGGTTTCCCAGAGTTTCGGATGGTTTGGAAGGTGGTCCGCCAGCGTGTGGTGGATGATCTGG
TATCCGTTCTGGATACGGACTATCTGGATATGGAACTAATTCCAAATCTCACTCGCCAAATTGCTGAGCAGTCTATCTAT
TCTTATATAGAAAATGGCCTCAAACTCCTTATTGATTATGCTCAGAAGGAAATCACCATTGACCACTCAAGCGACCGAGA
CAAGATTCTCATGGACATTGGCAAAGACCCTTATGTCGTTTCGATTAAATCAAAAGTCTATCTCCAAGACGGACGCCAAT
TTCAGTTTACCGAAAGTCGCCATAAGTTAGAAAAATTTAGATTTGTAGATTTTGCAAAACGCAAGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A062WVH4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  treR Streptococcus mutans UA159

59.322

100

0.593


Multiple sequence alignment