Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AAA990_RS02530 Genome accession   NZ_AP028605
Coordinates   494520..494669 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain Pne4     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 492849..493653 494520..494669 flank 867


Gene organization within MGE regions


Location: 492849..494669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAA990_RS02515 - 492849..493653 (+) 805 WP_128903587.1 IS5 family transposase -
  AAA990_RS02520 (TKY183112_04900) blpM 493803..494057 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AAA990_RS02525 (TKY183112_04910) blpN 494073..494276 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AAA990_RS02530 (TKY183112_04920) cipB 494520..494669 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=106111 AAA990_RS02530 WP_001818346.1 494520..494669(+) (cipB) [Streptococcus pneumoniae strain Pne4]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=106111 AAA990_RS02530 WP_001818346.1 494520..494669(+) (cipB) [Streptococcus pneumoniae strain Pne4]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment