Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACF0HW_RS16430 Genome accession   NZ_CP171208
Coordinates   3312523..3312642 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain HN11     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3307523..3317642
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF0HW_RS16405 - 3307764..3308522 (-) 759 WP_012116804.1 ABC transporter ATP-binding protein -
  ACF0HW_RS16410 - 3308516..3309463 (-) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  ACF0HW_RS16415 ceuB 3309453..3310406 (-) 954 WP_012116802.1 ABC transporter permease Machinery gene
  ACF0HW_RS16420 - 3310820..3312184 (+) 1365 WP_012116801.1 aspartate kinase -
  ACF0HW_RS16425 - 3312264..3312374 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACF0HW_RS16430 phrC 3312523..3312642 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACF0HW_RS16435 rapC 3312626..3313774 (-) 1149 WP_012116798.1 Rap family tetratricopeptide repeat protein Regulator
  ACF0HW_RS16440 - 3313927..3315360 (-) 1434 WP_162303988.1 HAMP domain-containing sensor histidine kinase -
  ACF0HW_RS16445 - 3315347..3316030 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1060508 ACF0HW_RS16430 WP_003156334.1 3312523..3312642(-) (phrC) [Bacillus amyloliquefaciens strain HN11]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1060508 ACF0HW_RS16430 WP_003156334.1 3312523..3312642(-) (phrC) [Bacillus amyloliquefaciens strain HN11]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment