Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   AAA980_RS02950 Genome accession   NZ_AP028604
Coordinates   548131..548280 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   A0A6I3TPS6
Organism   Streptococcus pneumoniae strain Pne3     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 519869..548280 548131..548280 within 0
IScluster/Tn 546459..547264 548131..548280 flank 867


Gene organization within MGE regions


Location: 519869..548280
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAA980_RS02800 (TKY182805_05480) - 519869..521149 (+) 1281 WP_001220758.1 restriction endonuclease subunit S -
  AAA980_RS02805 (TKY182805_05490) psrA 521206..522003 (+) 798 WP_000651177.1 tyrosine-type DNA invertase PsrA -
  AAA980_RS02810 (TKY182805_05500) - 522014..522622 (+) 609 WP_001859489.1 restriction endonuclease subunit S -
  AAA980_RS02815 (TKY182805_05510) - 522570..524135 (-) 1566 WP_050201932.1 restriction endonuclease subunit S -
  AAA980_RS02820 (TKY182805_05520) - 524135..525598 (-) 1464 WP_000029036.1 class I SAM-dependent DNA methyltransferase -
  AAA980_RS02825 (TKY182805_05530) - 525611..527944 (-) 2334 WP_000229105.1 DEAD/DEAH box helicase family protein -
  AAA980_RS02830 (TKY182805_05540) - 528552..529061 (+) 510 Protein_557 DUF2812 domain-containing protein -
  AAA980_RS02835 (TKY182805_05550) hrcA 529225..530259 (+) 1035 WP_000255781.1 heat-inducible transcriptional repressor HrcA -
  AAA980_RS02840 (TKY182805_05560) grpE 530286..530810 (+) 525 WP_000046035.1 nucleotide exchange factor GrpE -
  AAA980_RS02845 (TKY182805_05570) dnaK 531290..533113 (+) 1824 WP_000034662.1 molecular chaperone DnaK -
  AAA980_RS02850 (TKY182805_05580) - 533115..533471 (+) 357 WP_000114422.1 hypothetical protein -
  AAA980_RS02855 (TKY182805_05590) dnaJ 533873..535009 (+) 1137 WP_001066301.1 molecular chaperone DnaJ -
  AAA980_RS02860 (TKY182805_05600) - 535331..535618 (-) 288 WP_000777760.1 hypothetical protein -
  AAA980_RS02865 (TKY182805_05610) - 535628..536038 (-) 411 WP_001278301.1 HIT family protein -
  AAA980_RS02870 (TKY182805_05620) pptA 536106..536837 (+) 732 WP_000889919.1 ABC transporter ATP-binding protein Regulator
  AAA980_RS02875 (TKY182805_05630) - 536834..537883 (+) 1050 WP_000653773.1 ABC transporter permease -
  AAA980_RS02880 (TKY182805_05640) - 538051..538380 (-) 330 WP_000132572.1 hypothetical protein -
  AAA980_RS02885 (TKY182805_05650) - 538656..538994 (+) 339 WP_000682126.1 LytTR family DNA-binding domain-containing protein -
  AAA980_RS02890 (TKY182805_05660) comE/blpR 538999..539736 (+) 738 WP_001219143.1 response regulator transcription factor Regulator
  AAA980_RS02895 (TKY182805_05670) - 539750..541090 (+) 1341 WP_001028651.1 sensor histidine kinase -
  AAA980_RS02900 (TKY182805_05680) blpC 541135..541290 (-) 156 WP_000358814.1 quorum-sensing system pheromone BlpC -
  AAA980_RS02905 (TKY182805_05690) - 541347..542708 (-) 1362 WP_001069081.1 bacteriocin secretion accessory protein -
  AAA980_RS02910 (TKY182805_05700) - 542719..544766 (-) 2048 Protein_573 peptide cleavage/export ABC transporter -
  AAA980_RS02915 (TKY182805_05720) blpU 545047..545277 (+) 231 WP_001093268.1 bacteriocin-like peptide BlpU -
  AAA980_RS02920 - 545280..545399 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  AAA980_RS02925 (TKY182805_05730) - 545696..545860 (+) 165 WP_000727118.1 hypothetical protein -
  AAA980_RS02930 (TKY182805_05740) - 545857..546261 (+) 405 WP_000846944.1 hypothetical protein -
  AAA980_RS02935 - 546459..547264 (+) 806 Protein_578 IS5 family transposase -
  AAA980_RS02940 (TKY182805_05770) blpM 547414..547668 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AAA980_RS02945 (TKY182805_05780) blpN 547684..547887 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AAA980_RS02950 (TKY182805_05790) cipB 548131..548280 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=106033 AAA980_RS02950 WP_001813641.1 548131..548280(+) (cipB) [Streptococcus pneumoniae strain Pne3]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=106033 AAA980_RS02950 WP_001813641.1 548131..548280(+) (cipB) [Streptococcus pneumoniae strain Pne3]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I3TPS6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49

Multiple sequence alignment