Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   ACF3NK_RS12845 Genome accession   NZ_CP171104
Coordinates   2794178..2794474 (-) Length   98 a.a.
NCBI ID   WP_008710410.1    Uniprot ID   A0AAW5K377
Organism   Cloacibacillus evryensis strain WGS1925     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2793758..2815628 2794178..2794474 within 0


Gene organization within MGE regions


Location: 2793758..2815628
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF3NK_RS12845 (ACF3NK_12845) HI0659 2794178..2794474 (-) 297 WP_008710410.1 helix-turn-helix transcriptional regulator Machinery gene
  ACF3NK_RS12850 (ACF3NK_12850) - 2794467..2794832 (-) 366 WP_256196650.1 type II toxin-antitoxin system RelE/ParE family toxin -
  ACF3NK_RS12860 (ACF3NK_12860) - 2795460..2797661 (+) 2202 WP_256196649.1 cation-translocating P-type ATPase -
  ACF3NK_RS12865 (ACF3NK_12865) - 2797665..2797823 (+) 159 WP_256196647.1 heavy-metal-associated domain-containing protein -
  ACF3NK_RS12870 (ACF3NK_12870) tnpC 2797989..2799581 (-) 1593 WP_392438195.1 IS66 family transposase -
  ACF3NK_RS12875 (ACF3NK_12875) tnpB 2799652..2800005 (-) 354 WP_256196737.1 IS66 family insertion sequence element accessory protein TnpB -
  ACF3NK_RS12880 (ACF3NK_12880) - 2800253..2800900 (-) 648 WP_256196464.1 lactate utilization protein -
  ACF3NK_RS12885 (ACF3NK_12885) - 2800984..2801124 (-) 141 WP_083829610.1 tautomerase family protein -
  ACF3NK_RS12890 (ACF3NK_12890) ilvD 2801141..2802865 (-) 1725 WP_256196462.1 dihydroxy-acid dehydratase -
  ACF3NK_RS12895 (ACF3NK_12895) - 2802897..2804042 (-) 1146 WP_256196460.1 amidohydrolase family protein -
  ACF3NK_RS12900 (ACF3NK_12900) - 2804064..2805212 (-) 1149 WP_008710383.1 mandelate racemase/muconate lactonizing enzyme family protein -
  ACF3NK_RS12905 (ACF3NK_12905) - 2805257..2806843 (-) 1587 WP_256196458.1 sodium:solute symporter family protein -
  ACF3NK_RS12910 (ACF3NK_12910) - 2807150..2807830 (+) 681 WP_256196456.1 GntR family transcriptional regulator -
  ACF3NK_RS12915 (ACF3NK_12915) - 2807890..2808606 (-) 717 WP_256196455.1 GntR family transcriptional regulator -
  ACF3NK_RS12920 (ACF3NK_12920) rhuM 2808733..2809671 (-) 939 WP_256196453.1 RhuM family protein -
  ACF3NK_RS12925 (ACF3NK_12925) ggt 2809886..2811589 (-) 1704 WP_256196451.1 gamma-glutamyltransferase -
  ACF3NK_RS12930 (ACF3NK_12930) - 2811651..2812790 (-) 1140 WP_256196448.1 succinylglutamate desuccinylase/aspartoacylase family protein -
  ACF3NK_RS12935 (ACF3NK_12935) - 2812806..2812949 (-) 144 WP_256196446.1 hypothetical protein -
  ACF3NK_RS12940 (ACF3NK_12940) - 2812965..2814251 (-) 1287 WP_256196444.1 TRAP transporter large permease subunit -
  ACF3NK_RS12945 (ACF3NK_12945) - 2814258..2814806 (-) 549 WP_256196442.1 DUF6305 family protein -
  ACF3NK_RS12950 (ACF3NK_12950) - 2814963..2815586 (-) 624 WP_256196440.1 response regulator -

Sequence

Protein


Download         Length: 98 a.a.        Molecular weight: 10690.53 Da        Isoelectric Point: 10.4094

>NTDB_id=1060045 ACF3NK_RS12845 WP_008710410.1 2794178..2794474(-) (HI0659) [Cloacibacillus evryensis strain WGS1925]
MSEKAISPKGRSWSEVREQILTPEERGASNLRVAMMVELAAARAEKGISQKKLEALSGVKQPVIARMEKGYTSPQLDTVL
KVLAPLGKTLYIGDLPRA

Nucleotide


Download         Length: 297 bp        

>NTDB_id=1060045 ACF3NK_RS12845 WP_008710410.1 2794178..2794474(-) (HI0659) [Cloacibacillus evryensis strain WGS1925]
ATGAGTGAAAAAGCTATCAGCCCAAAGGGGCGCAGCTGGAGCGAGGTGCGCGAGCAGATTTTGACGCCAGAGGAGAGGGG
CGCGTCCAATCTGCGAGTCGCGATGATGGTTGAATTGGCCGCCGCGAGGGCGGAGAAGGGCATTTCACAGAAAAAACTCG
AGGCTTTGAGCGGCGTAAAACAGCCTGTTATCGCGCGTATGGAGAAGGGATATACCAGCCCGCAGCTGGATACTGTCCTT
AAGGTTTTGGCCCCTTTGGGCAAGACTCTTTATATAGGGGATCTGCCGAGGGCGTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(39-90)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

63.218

88.776

0.561

Multiple sequence alignment