Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACFW98_RS08840 Genome accession   NZ_CP170719
Coordinates   1850992..1851132 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain JP5008     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1845992..1856132
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFW98_RS08815 (ACFW98_08815) - 1846338..1846721 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  ACFW98_RS08820 (ACFW98_08820) comA 1846743..1847387 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACFW98_RS08825 (ACFW98_08825) comP 1847468..1849768 (-) 2301 WP_032867184.1 histidine kinase Regulator
  ACFW98_RS08830 (ACFW98_08830) comX 1849782..1849955 (-) 174 WP_012118314.1 competence pheromone ComX -
  ACFW98_RS08835 (ACFW98_08835) - 1849924..1850784 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  ACFW98_RS08840 (ACFW98_08840) degQ 1850992..1851132 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACFW98_RS08845 (ACFW98_08845) - 1851598..1851939 (+) 342 WP_007408677.1 hypothetical protein -
  ACFW98_RS08850 (ACFW98_08850) - 1851946..1853169 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACFW98_RS08855 (ACFW98_08855) - 1853299..1854765 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  ACFW98_RS08860 (ACFW98_08860) - 1854783..1855334 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACFW98_RS08865 (ACFW98_08865) - 1855431..1855829 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1058735 ACFW98_RS08840 WP_003152043.1 1850992..1851132(-) (degQ) [Bacillus amyloliquefaciens strain JP5008]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1058735 ACFW98_RS08840 WP_003152043.1 1850992..1851132(-) (degQ) [Bacillus amyloliquefaciens strain JP5008]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment