Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | AABA08_RS02375 | Genome accession | NZ_AP028602 |
| Coordinates | 474488..474637 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PF2 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 469488..479637
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABA08_RS02350 (TKY092604_04540) | blpC | 469774..469902 (-) | 129 | WP_000358815.1 | quorum-sensing system pheromone BlpC | - |
| AABA08_RS02355 (TKY092604_04550) | - | 469959..471320 (-) | 1362 | WP_001069072.1 | bacteriocin secretion accessory protein | - |
| AABA08_RS02360 (TKY092604_04560) | blpA | 471331..473489 (-) | 2159 | Protein_464 | peptide cleavage/export ABC transporter BlpA | - |
| AABA08_RS02365 (TKY092604_04580) | blpM | 473771..474025 (+) | 255 | WP_001093256.1 | two-peptide bacteriocin subunit BlpM | - |
| AABA08_RS02370 (TKY092604_04590) | blpN | 474041..474244 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| AABA08_RS02375 (TKY092604_04600) | cipB | 474488..474637 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| AABA08_RS10510 | - | 474673..474738 (+) | 66 | Protein_468 | ComC/BlpC family peptide pheromone/bacteriocin | - |
| AABA08_RS02380 | - | 474741..474860 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| AABA08_RS02385 (TKY092604_04610) | - | 475158..475322 (+) | 165 | WP_000727117.1 | hypothetical protein | - |
| AABA08_RS02390 | - | 475384..475722 (+) | 339 | WP_088804618.1 | immunity protein | - |
| AABA08_RS02395 (TKY092604_04640) | - | 476351..476734 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| AABA08_RS02400 (TKY092604_04650) | - | 476786..477475 (+) | 690 | WP_000760520.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AABA08_RS02405 (TKY092604_04660) | blpZ | 477517..477765 (+) | 249 | WP_000276501.1 | immunity protein BlpZ | - |
| AABA08_RS02410 | - | 477795..478406 (+) | 612 | WP_000394036.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AABA08_RS02415 (TKY092604_04670) | ccrZ | 478567..479361 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=105871 AABA08_RS02375 WP_001809846.1 474488..474637(+) (cipB) [Streptococcus pneumoniae strain PF2]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=105871 AABA08_RS02375 WP_001809846.1 474488..474637(+) (cipB) [Streptococcus pneumoniae strain PF2]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |