Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACFXAD_RS18685 Genome accession   NZ_CP170653
Coordinates   3764141..3764260 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain JP5011     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3759141..3769260
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAD_RS18660 (ACFXAD_18660) - 3759382..3760140 (-) 759 WP_053573731.1 ABC transporter ATP-binding protein -
  ACFXAD_RS18665 (ACFXAD_18665) - 3760134..3761081 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACFXAD_RS18670 (ACFXAD_18670) ceuB 3761071..3762024 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  ACFXAD_RS18675 (ACFXAD_18675) - 3762438..3763802 (+) 1365 WP_033575080.1 aspartate kinase -
  ACFXAD_RS18680 (ACFXAD_18680) - 3763882..3763992 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACFXAD_RS18685 (ACFXAD_18685) phrC 3764141..3764260 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACFXAD_RS18690 (ACFXAD_18690) rapC 3764244..3765392 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  ACFXAD_RS18695 (ACFXAD_18695) - 3765545..3766978 (-) 1434 WP_162782989.1 HAMP domain-containing sensor histidine kinase -
  ACFXAD_RS18700 (ACFXAD_18700) - 3766965..3767648 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1058525 ACFXAD_RS18685 WP_003156334.1 3764141..3764260(-) (phrC) [Bacillus amyloliquefaciens strain JP5011]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1058525 ACFXAD_RS18685 WP_003156334.1 3764141..3764260(-) (phrC) [Bacillus amyloliquefaciens strain JP5011]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment