Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ACFXAB_RS01180 Genome accession   NZ_CP170650
Coordinates   210862..210981 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain JP5039     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 205862..215981
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAB_RS01155 (ACFXAB_01155) - 206101..206859 (-) 759 WP_012116804.1 ABC transporter ATP-binding protein -
  ACFXAB_RS01160 (ACFXAB_01160) - 206853..207800 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACFXAB_RS01165 (ACFXAB_01165) ceuB 207790..208743 (-) 954 WP_014416904.1 ABC transporter permease Machinery gene
  ACFXAB_RS01170 (ACFXAB_01170) - 209157..210521 (+) 1365 WP_014416903.1 aspartate kinase -
  ACFXAB_RS01175 (ACFXAB_01175) - 210601..210711 (+) 111 WP_369878517.1 YjcZ family sporulation protein -
  ACFXAB_RS01180 (ACFXAB_01180) phrC 210862..210981 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACFXAB_RS01185 (ACFXAB_01185) rapC 210965..212113 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  ACFXAB_RS01190 (ACFXAB_01190) - 212272..213699 (-) 1428 WP_088056326.1 HAMP domain-containing sensor histidine kinase -
  ACFXAB_RS01195 (ACFXAB_01195) - 213686..214369 (-) 684 WP_014416901.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1058304 ACFXAB_RS01180 WP_003156334.1 210862..210981(-) (phrC) [Bacillus velezensis strain JP5039]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1058304 ACFXAB_RS01180 WP_003156334.1 210862..210981(-) (phrC) [Bacillus velezensis strain JP5039]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment