Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | O4J27_RS11670 | Genome accession | NZ_CP170372 |
| Coordinates | 2435390..2435563 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain P12 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2430390..2440563
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4J27_RS11655 (O4J27_11655) | gcvT | 2431204..2432304 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| O4J27_RS11660 (O4J27_11660) | - | 2432727..2434397 (+) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| O4J27_RS11665 (O4J27_11665) | - | 2434419..2435213 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| O4J27_RS11670 (O4J27_11670) | sinI | 2435390..2435563 (+) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| O4J27_RS11675 (O4J27_11675) | sinR | 2435597..2435932 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| O4J27_RS11680 (O4J27_11680) | tasA | 2435980..2436765 (-) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| O4J27_RS11685 (O4J27_11685) | sipW | 2436830..2437414 (-) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| O4J27_RS11690 (O4J27_11690) | tapA | 2437386..2438057 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| O4J27_RS11695 (O4J27_11695) | - | 2438316..2438645 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| O4J27_RS11700 (O4J27_11700) | - | 2438686..2438865 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| O4J27_RS11705 (O4J27_11705) | comGG | 2438922..2439299 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| O4J27_RS11710 (O4J27_11710) | comGF | 2439300..2439800 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| O4J27_RS11715 (O4J27_11715) | comGE | 2439709..2440023 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| O4J27_RS11720 (O4J27_11720) | comGD | 2440007..2440444 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=1056421 O4J27_RS11670 WP_032874029.1 2435390..2435563(+) (sinI) [Bacillus velezensis strain P12]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1056421 O4J27_RS11670 WP_032874029.1 2435390..2435563(+) (sinI) [Bacillus velezensis strain P12]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |