Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACFBUK_RS14785 Genome accession   NZ_CP170331
Coordinates   2998787..2998927 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GDMCC 820630     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2993787..3003927
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFBUK_RS14760 (ACFBUK_14760) - 2994133..2994516 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  ACFBUK_RS14765 (ACFBUK_14765) comA 2994538..2995182 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACFBUK_RS14770 (ACFBUK_14770) comP 2995263..2997563 (-) 2301 WP_032876801.1 histidine kinase Regulator
  ACFBUK_RS14775 (ACFBUK_14775) comX 2997577..2997750 (-) 174 WP_012118314.1 competence pheromone ComX -
  ACFBUK_RS14780 (ACFBUK_14780) - 2997719..2998579 (-) 861 WP_142925231.1 polyprenyl synthetase family protein -
  ACFBUK_RS14785 (ACFBUK_14785) degQ 2998787..2998927 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACFBUK_RS14790 (ACFBUK_14790) - 2999393..2999734 (+) 342 WP_032876795.1 hypothetical protein -
  ACFBUK_RS14795 (ACFBUK_14795) - 2999741..3000964 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  ACFBUK_RS14800 (ACFBUK_14800) - 3001094..3002560 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ACFBUK_RS14805 (ACFBUK_14805) - 3002578..3003129 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACFBUK_RS14810 (ACFBUK_14810) - 3003226..3003624 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1056167 ACFBUK_RS14785 WP_003152043.1 2998787..2998927(-) (degQ) [Bacillus velezensis strain GDMCC 820630]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1056167 ACFBUK_RS14785 WP_003152043.1 2998787..2998927(-) (degQ) [Bacillus velezensis strain GDMCC 820630]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment