Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   AB3Z04_RS11725 Genome accession   NZ_CP170168
Coordinates   2440326..2440763 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain BS2-7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435326..2445763
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3Z04_RS11675 sinI 2435709..2435882 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  AB3Z04_RS11680 sinR 2435916..2436251 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB3Z04_RS11685 tasA 2436299..2437084 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  AB3Z04_RS11690 sipW 2437149..2437733 (-) 585 WP_032874025.1 signal peptidase I SipW -
  AB3Z04_RS11695 tapA 2437705..2438376 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  AB3Z04_RS11700 - 2438635..2438964 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  AB3Z04_RS11705 - 2439005..2439184 (-) 180 WP_022552966.1 YqzE family protein -
  AB3Z04_RS11710 comGG 2439241..2439618 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB3Z04_RS11715 comGF 2439619..2440119 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  AB3Z04_RS11720 comGE 2440028..2440342 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  AB3Z04_RS11725 comGD 2440326..2440763 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB3Z04_RS11730 comGC 2440753..2441061 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB3Z04_RS11735 comGB 2441066..2442103 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB3Z04_RS11740 comGA 2442090..2443160 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AB3Z04_RS11745 - 2443357..2444307 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  AB3Z04_RS11750 - 2444453..2445754 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=1055391 AB3Z04_RS11725 WP_007612572.1 2440326..2440763(-) (comGD) [Bacillus velezensis strain BS2-7]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1055391 AB3Z04_RS11725 WP_007612572.1 2440326..2440763(-) (comGD) [Bacillus velezensis strain BS2-7]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment