Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   AB3Z04_RS02020 Genome accession   NZ_CP170168
Coordinates   398012..398131 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain BS2-7     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 393012..403131
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3Z04_RS02005 - 394624..395307 (+) 684 WP_032872879.1 response regulator transcription factor -
  AB3Z04_RS02010 - 395294..396727 (+) 1434 WP_161503657.1 HAMP domain-containing sensor histidine kinase -
  AB3Z04_RS02015 rapC 396880..398028 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  AB3Z04_RS02020 phrC 398012..398131 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB3Z04_RS02025 - 398282..398392 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  AB3Z04_RS02030 - 398472..399836 (-) 1365 WP_007609394.1 aspartate kinase -
  AB3Z04_RS02035 ceuB 400250..401203 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  AB3Z04_RS02040 - 401193..402140 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  AB3Z04_RS02045 - 402134..402892 (+) 759 WP_007609404.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1055357 AB3Z04_RS02020 WP_003156334.1 398012..398131(+) (phrC) [Bacillus velezensis strain BS2-7]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1055357 AB3Z04_RS02020 WP_003156334.1 398012..398131(+) (phrC) [Bacillus velezensis strain BS2-7]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment