Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACE6HX_RS14860 Genome accession   NZ_CP170098
Coordinates   2879829..2879969 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain X14-67     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2874829..2884969
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACE6HX_RS14835 (ACE6HX_14835) - 2875095..2875484 (-) 390 WP_034659822.1 hotdog fold thioesterase -
  ACE6HX_RS14840 (ACE6HX_14840) comA 2875508..2876149 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  ACE6HX_RS14845 (ACE6HX_14845) comP 2876230..2878542 (-) 2313 WP_375566249.1 ATP-binding protein Regulator
  ACE6HX_RS14850 (ACE6HX_14850) - 2878596..2878766 (-) 171 WP_080869541.1 competence pheromone ComX -
  ACE6HX_RS14855 (ACE6HX_14855) - 2878763..2879677 (-) 915 WP_034659828.1 polyprenyl synthetase family protein -
  ACE6HX_RS14860 (ACE6HX_14860) degQ 2879829..2879969 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACE6HX_RS14865 (ACE6HX_14865) - 2880475..2880828 (+) 354 WP_060597216.1 hypothetical protein -
  ACE6HX_RS14870 (ACE6HX_14870) - 2880862..2882088 (-) 1227 WP_060597217.1 EAL and HDOD domain-containing protein -
  ACE6HX_RS14875 (ACE6HX_14875) - 2882227..2883696 (-) 1470 WP_034659831.1 nicotinate phosphoribosyltransferase -
  ACE6HX_RS14880 (ACE6HX_14880) - 2883714..2884265 (-) 552 WP_127687105.1 cysteine hydrolase family protein -
  ACE6HX_RS14885 (ACE6HX_14885) - 2884326..2884733 (-) 408 WP_060597219.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1055035 ACE6HX_RS14860 WP_003213123.1 2879829..2879969(-) (degQ) [Bacillus pumilus strain X14-67]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1055035 ACE6HX_RS14860 WP_003213123.1 2879829..2879969(-) (degQ) [Bacillus pumilus strain X14-67]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment